[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ssuC1
DDBJ      :ssuC1        putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  384/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   89->249 PF00528 * BPD_transp_1 5e-04 31.1 %
:HMM:PFM   74->243 PF00528 * BPD_transp_1 5e-24 26.2 168/185  
:BLT:SWISS 22->244 Y355_HAEIN 3e-22 26.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69049.1 GT:GENE ssuC1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1650462..1651235 GB:FROM 1650462 GB:TO 1651235 GB:DIRECTION + GB:GENE ssuC1 GB:PRODUCT putative ABC transporter permease protein GB:NOTE sulfonate/nitrate/taurine transport system permease protein, PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC69049.1 LENGTH 257 SQ:AASEQ MRAVLRAVWPPLLVLVVLVTGWQWYVSAAGVDPTVLPGPGRVLSEGWSNRTDLWDQTLPTLQETLLGFALSFAAAWLVAVVLDFSAVARRGLYPLLVASQTIPIVAVAPLLIIWFGFGLLPKMLVVTLTTFFPLAANLAAGFAATDRDAMRLLRSLGTGRLRAFRLVRVPSALPHFFTGLRVSITYAVVGAVFAEYAGAEKGLGIYMQAQKSAFRTDLVFAAVTVTALLSIALFGATCLLQRLVLPWERALVKEGTS GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 22->244|Y355_HAEIN|3e-22|26.9|223/245| TM:NTM 5 TM:REGION 1->21| TM:REGION 63->85| TM:REGION 94->116| TM:REGION 123->145| TM:REGION 221->243| SEG 12->19|llvlvvlv| SEG 131->144|ffplaanlaagfaa| SEG 151->162|rllrslgtgrlr| RP:PFM:NREP 1 RP:PFM:REP 89->249|PF00528|5e-04|31.1|161/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 74->243|PF00528|5e-24|26.2|168/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| OP:NHOMO 850 OP:NHOMOORG 388 OP:PATTERN --------------------------------1--------------------1-------------- ----1---112---111----1---7------22224453-5-6411-----1-------11--2-1412112221111--13---------------------------111111111111111----------122222---11---1---1211---------2---1-------------1------1-1222222332232223-111112221-31---------1A1--------------------------------------1-------------1--11111111111-------------111---111--1113-------1-111221---2-2--2----43-3------111--11--11--------12969-1451-5133323232339-336424334A1-B88533576444B3---5343433344111111111-1-1--1--------------------------------1--3AA72133331-222133372222123282222-12211-2--2-2286-1--1--1------------1-1-21111--------11--1-1-------1-1---------------------------1-------------------------------1----------3241-122222222222-222222221222222222244432-------------------21112122--122222212222----------------111-1----111----111111-2--14-33221233-31222332----------1111-----111--1-2--------------3-----------------------------------------------1-111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 254-257| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccc //