[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ssuC2
DDBJ      :ssuC2        putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  608/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->198 3dhwA PDBj 3e-07 31.2 %
:RPS:PDB   159->194 3dhwA PDBj 2e-12 38.9 %
:RPS:SCOP  63->261 2r6gG1  f.58.1.1 * 1e-17 15.1 %
:RPS:PFM   130->258 PF00528 * BPD_transp_1 2e-07 33.3 %
:HMM:PFM   89->257 PF00528 * BPD_transp_1 2.7e-29 27.8 169/185  
:HMM:PFM   75->101 PF10247 * Romo1 0.00055 33.3 27/67  
:BLT:SWISS 27->265 SSUC_ECOLI 9e-50 41.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69269.1 GT:GENE ssuC2 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1920171..1920977 GB:FROM 1920171 GB:TO 1920977 GB:DIRECTION + GB:GENE ssuC2 GB:PRODUCT putative ABC transporter permease protein GB:NOTE sulfonate/nitrate/taurine transport system permease protein GB:PROTEIN_ID BAC69269.1 LENGTH 268 SQ:AASEQ MPALEPIVPASTRRTRVPRWLRRTSGPVLLLLLWQLLSSTGVLTSDVLASPGRIAQVARDLVVDGSLPNAMGVSLQRVAVGLLFGAAIGTGLALVSGLFRAGEDLVDASVQMLRTVPFVGLIPLFIIWFGIGEAPKIAIITLGVSFPLYLNVYAGIRGVDSQLIEAGESLGLSRWGLVRHVVLPGALPGAMTGLRYSLGIAWLALVFAEQINADAGIGFLMVQARDFLRTDVIVVCLIVYAFLGLLADFVVRSLERLLLQWRPTFTGR GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 27->265|SSUC_ECOLI|9e-50|41.8|239/263| TM:NTM 6 TM:REGION 32->54| TM:REGION 78->100| TM:REGION 109->131| TM:REGION 134->156| TM:REGION 201->223| TM:REGION 231->253| SEG 12->24|trrtrvprwlrrt| SEG 29->37|lllllwqll| BL:PDB:NREP 1 BL:PDB:REP 74->198|3dhwA|3e-07|31.2|125/203| RP:PDB:NREP 1 RP:PDB:REP 159->194|3dhwA|2e-12|38.9|36/203| RP:PFM:NREP 1 RP:PFM:REP 130->258|PF00528|2e-07|33.3|129/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 89->257|PF00528|2.7e-29|27.8|169/185|BPD_transp_1| HM:PFM:REP 75->101|PF10247|0.00055|33.3|27/67|Romo1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 63->261|2r6gG1|1e-17|15.1|199/284|f.58.1.1| OP:NHOMO 2296 OP:NHOMOORG 640 OP:PATTERN ----1----------------1-3----1-1-11-2112222233111121121------1-----21 -1--71-1113-2-433----2---C------25557B95-526322--12-725122--12--5348363111111121-32----1-----111----------11--1111111111111121---1-----124423---242-3222323343-1-113213432-1-----------1211----1-5444444554454445924436443214221-1111113D222222222222222233221-21321-1-122--541-2-11---11111-1233222222222221111111111111211---1111112491112322222349921113341-51---A915211--62111-11--2222------56JLU-35B33D46665656565B-DDGCBDCB6D3-NAAB75A99AAAOF1--7394866534323333332-1-44-2-----------------------------1-11-15GEC65DEGE564553AA8B555534E8RB8B8-3774255237655IE161163521-------21-1231271231-111--2126--2-31-222229151211-----------------1-----3121121-2-3---------------------1-211------6476-342222222222-22222222222222222236A6981112212222222222222511321221-244444424444----11111-----24311-1-11-111-1--15554514--1A6A8798AB7468485888---------31221-----343221-31111----------3--------------1----------------------------12-111121--2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------------------2--3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 46.6 SQ:SECSTR #########################################################################HHHHHHHHHHHHHHTTGGGGGGGGGGTTccccHHHHHHHHHHccHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHH###################################################################### DISOP:02AL 9-11, 265-268| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //