[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : tdh
DDBJ      :tdh          putative threonine 3-dehydrogenase
Swiss-Prot:TDH_STRAW    RecName: Full=L-threonine 3-dehydrogenase;         EC=1.1.1.103;

Homologs  Archaea  47/68 : Bacteria  712/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
b.35.1c.2.1
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->339 2dq4A PDBj 1e-68 43.3 %
:RPS:PDB   1->338 2eerB PDBj 4e-48 24.4 %
:RPS:SCOP  1->153 1bxzA1  b.35.1.2 * 2e-33 28.2 %
:RPS:SCOP  139->304 1h2bA2  c.2.1.1 * 5e-15 19.5 %
:HMM:SCOP  1->173 1pl7A1 b.35.1.2 * 7.9e-55 50.6 %
:HMM:SCOP  138->307 1d1tA2 c.2.1.1 * 1.8e-35 27.1 %
:RPS:PFM   26->132 PF08240 * ADH_N 5e-22 50.0 %
:RPS:PFM   191->292 PF00107 * ADH_zinc_N 8e-06 28.4 %
:HMM:PFM   25->133 PF08240 * ADH_N 8e-35 47.7 107/109  
:HMM:PFM   174->301 PF00107 * ADH_zinc_N 1.7e-25 27.6 127/130  
:BLT:SWISS 1->342 TDH_STRAW 0.0 100.0 %
:PROS 62->76|PS00059|ADH_ZINC
:PROS 35->49|PS00678|WD_REPEATS_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69339.1 GT:GENE tdh GT:PRODUCT putative threonine 3-dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1996980..1998008) GB:FROM 1996980 GB:TO 1998008 GB:DIRECTION - GB:GENE tdh GB:PRODUCT putative threonine 3-dehydrogenase GB:NOTE PF08240: Alcohol dehydrogenase GroES-like domain GB:PROTEIN_ID BAC69339.1 LENGTH 342 SQ:AASEQ MKALVKEKAEPGLWLMDVPEPEIGPGDVLIKVLRTGICGTDLHIRSWDGWAQQAVRTPLVLGHEFVGEVVETGRDVVDIKAGDRVSGEGHLVCGKCRNCQAGRRHLCRATVGLGVGRDGAFAEYVALPAANVWVHRVPVDLDVAAIFDPFGNAVHTALSFPLVGEDVLITGAGPIGLMAAAVARHAGARNVMITDVSEERLELARKIGVSLALNVADTTIADGQRALGLREGFDIGLEMSGRPEAMRDMIANMTHGGRIAMLGLPSQEFPVDWARIVTSMITIKGIYGREMFETWYAMSVLLEGGLDLAPVITGRYGYRDYEAAFADAASGRGGKVILDWTL GT:EXON 1|1-342:0| SW:ID TDH_STRAW SW:DE RecName: Full=L-threonine 3-dehydrogenase; EC=1.1.1.103; SW:GN Name=tdh; OrderedLocusNames=SAV_1628; SW:KW Complete proteome; Cytoplasm; Metal-binding; NAD; Oxidoreductase;Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->342|TDH_STRAW|0.0|100.0|342/342| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 62->76|PS00059|ADH_ZINC|PDOC00058| PROS 35->49|PS00678|WD_REPEATS_1|PDOC00574| SEG 179->188|aaavarhaga| BL:PDB:NREP 1 BL:PDB:REP 1->339|2dq4A|1e-68|43.3|337/343| RP:PDB:NREP 1 RP:PDB:REP 1->338|2eerB|4e-48|24.4|336/347| RP:PFM:NREP 2 RP:PFM:REP 26->132|PF08240|5e-22|50.0|104/108|ADH_N| RP:PFM:REP 191->292|PF00107|8e-06|28.4|102/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 25->133|PF08240|8e-35|47.7|107/109|ADH_N| HM:PFM:REP 174->301|PF00107|1.7e-25|27.6|127/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 2 RP:SCP:REP 1->153|1bxzA1|2e-33|28.2|149/178|b.35.1.2| RP:SCP:REP 139->304|1h2bA2|5e-15|19.5|164/172|c.2.1.1| HM:SCP:REP 1->173|1pl7A1|7.9e-55|50.6|172/186|b.35.1.2|1/1|GroES-like| HM:SCP:REP 138->307|1d1tA2|1.8e-35|27.1|170/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4833 OP:NHOMOORG 941 OP:PATTERN 222-2-68FFFGFHG8174323--92213362-1----------1---1-111-11121114222-35 77D-822544511266755-5E11BM666665EIIJAKMD274CG7932422EDG7451123A5A3HFEA62111-311--2D112111122-2-----2-5-4-61423--------------11--1--11--136643111385337222--------1---24879-------------44333541727333333452443334C55545332421262233333235233333333333333433321-4--3-7--144661-1-13383223221222311333323334342222222222222322111222232--4332333323274--1-1---21-111--212141221232231-353862251111184ABE5-69756744554554448-75448A57587-EDD8GDGFFCFH583536496578736333333334764-121------------------------------2A82222213CAAAACC9799AABEAAAA28A8D5B86--22A24253654157212-1-12-323223211241-2321--1--12----33311122134758C33-----111111--------------33221233417413111122432212242122---12--------2552235B88CBCCCAB-8BAABAAAAB8BABBABB56853544296A598B99BB68659764566581-233334333333---3111114333113A81114-2-111--23-3333412121A175873745456554565111212111-133111111121114465754333------13111122--------1--------31--1-------21-----1311124333242 ----522-42---25HOKIJITGRTSMBB78788769847566764GFHJLNYZEHDC9A8A65D16334348377856835566664-FUAO8C6JDC8577959-432K1322211111-52542213A2-23112-1312422211-211234347795-672433784534235-711-3486CDJ5832PLMI1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 342 STR:RPRED 100.0 SQ:SECSTR cEEEEEccTTcccEEEEcccccccTTcEEEEEEEEEEcTHHHHHHHEETTTTTcccccEEcccEEEEEEEEEcTTcccccTTcEEEEccEEcccccHHHHTTcGGGccccEEcTTTcccccccEEEEccGGGEEEcccccHHHHGGGGTHHHHHHHHHHHTTccTTEEETTTcHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHTTccEEEETTTccHHHHHHHHTTTccEEEEEEccccHHHHTTGGGGEEEEEEEEEcccccccccccHHHHHHHTcEEEEcccccHHHHHHHHHHHHTTccccTccEEEEEEGGGHHHHHHHHHTTcccEEEEETEE DISOP:02AL 342-343| PSIPRED cEEEEEEcccccEEEEEEEcccccccEEEEEEEEEEEEccEEEEEEccccccccccccEEcccccEEEEEEEcccccccccccEEEEcccccccccHHHHcccccccccccEEEEccccccEEEEEEcHHHEEEccccccHHHHHcccHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHHccEEEEEEEcccHHHHHHHHHHHHHcccccHHHEEEEEEHHHHHHHHHHHHccccEEEEEEEcc //