[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : terD1
DDBJ      :terD1        putative tellurium resistance protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
b.18.1
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->191 3ibzA PDBj 7e-84 83.5 %
:RPS:PDB   1->178 2a5iA PDBj 2e-43 14.0 %
:RPS:SCOP  2->110 1wmdA1  b.18.1.20 * 6e-22 17.9 %
:RPS:PFM   61->183 PF02342 * TerD 2e-41 69.1 %
:HMM:PFM   60->182 PF02342 * TerD 5.9e-52 54.5 123/128  
:HMM:PFM   3->36 PF10138 * Tellurium_res 0.00018 32.4 34/99  
:BLT:SWISS 1->190 TERD_SERMA 8e-75 68.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68606.1 GT:GENE terD1 GT:PRODUCT putative tellurium resistance protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1074296..1074871 GB:FROM 1074296 GB:TO 1074871 GB:DIRECTION + GB:GENE terD1 GB:PRODUCT putative tellurium resistance protein GB:NOTE PF02342: Bacterial stress protein GB:PROTEIN_ID BAC68606.1 LENGTH 191 SQ:AASEQ MGVSLSKGGNVSLSKEAPGLTAVLVGLGWDVRTTTGTDYDLDASALLVDTSGKVLSDQHFIFYNNLKSPDGSVEHTGDNLTGEGEGDDESVKVNLAAVPAEVDKIVFPVSIHDAESRGQSFGQVRNAFIRVVNQAGGQEIARYDLSEDASTETAMVFGELYRNGADWKFRAVGQGYASGLSGIASDFGVNV GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 1->190|TERD_SERMA|8e-75|68.4|190/192| BL:PDB:NREP 1 BL:PDB:REP 13->191|3ibzA|7e-84|83.5|176/176| RP:PDB:NREP 1 RP:PDB:REP 1->178|2a5iA|2e-43|14.0|164/306| RP:PFM:NREP 1 RP:PFM:REP 61->183|PF02342|2e-41|69.1|123/125|TerD| HM:PFM:NREP 2 HM:PFM:REP 60->182|PF02342|5.9e-52|54.5|123/128|TerD| HM:PFM:REP 3->36|PF10138|0.00018|32.4|34/99|Tellurium_res| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02342|IPR003325| RP:SCP:NREP 1 RP:SCP:REP 2->110|1wmdA1|6e-22|17.9|106/116|b.18.1.20| OP:NHOMO 420 OP:NHOMOORG 101 OP:PATTERN -------------------------------------------------------------------- ------------------------------------9675-8774-----------------1----BFF-----------------------------------3---2-------------------------------------4--33-----------21----14--------------5-------3444443333343334--3353333---3---------4----------------------------------------------3----------------------------------------------32------------5114----4----------73-----------------------------------------------------------------------1--------------------------------3-------------------------------------------1-----------------52----------------6------1----------------4-----------------------------------------------------------------------4----------------------2----------6------48----6---4---------4---------66----4---------------------------55555555555------------------------------3--------5454----------------554----------------------------------------1-------------------------------------------------------- ----61------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 100.0 SQ:SECSTR EEccccTTcEEEEEEEEEEEEEEEccTTccccccEEEEEETTEEEEEEETccEEEEcTTcccccccccccccccccccccccHHHHHHHHHHHHHTTccTTcccccccHHHHHHHHHTcccccHHHHHHTHHHHHHTccHHHHHHHHHHHHHHHHcHHHHHHHcTEcTTcccETTcccHHHHHHHHTTccc DISOP:02AL 6-7| PSIPRED cEEEEEcccccccccccccccEEEEEEEEEEcccccccccEEEEEEEEcccccccccccEEEccccccccccEEEcccccccccccccEEEEEEcccccccccEEEEEEEEcccccccccHHHccccEEEEEEccccEEEEEEEEccccccEEEEEEEEEEEEcccEEEEEccccccccHHHHHHHccccc //