[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : thiX1
DDBJ      :thiX1        putative flavin-dependent reductase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  351/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->164 2qckA PDBj 3e-26 46.0 %
:RPS:PDB   17->166 2d37A PDBj 3e-34 26.4 %
:RPS:SCOP  17->165 1wgbA  b.45.1.2 * 3e-38 28.2 %
:HMM:SCOP  12->167 1yoaA1 b.45.1.2 * 6.3e-45 40.0 %
:RPS:PFM   28->161 PF01613 * Flavin_Reduct 2e-17 44.8 %
:HMM:PFM   21->166 PF01613 * Flavin_Reduct 5.1e-39 36.6 145/155  
:BLT:SWISS 8->163 NTAB_CHEHE 4e-22 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69192.1 GT:GENE thiX1 GT:PRODUCT putative flavin-dependent reductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1826786..1827292) GB:FROM 1826786 GB:TO 1827292 GB:DIRECTION - GB:GENE thiX1 GB:PRODUCT putative flavin-dependent reductase GB:NOTE PF01613: Flavin reductase like domain GB:PROTEIN_ID BAC69192.1 LENGTH 168 SQ:AASEQ MTATPDLGTQLASPDLLRSVFRRHAAGVAVITARGDGGPVGFTATSLTSVSAEPPLVSFGIGVGASSWPAISETAHVGVHILGEHQQELAGVFAKSGADRFGASTGWREGPEGVPVLDDVLAWLVCRVVARVPAGDHRIVLAEVVLGDPTGAGRPLLYHQGRFSGLRD GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 8->163|NTAB_CHEHE|4e-22|36.4|154/322| BL:PDB:NREP 1 BL:PDB:REP 21->164|2qckA|3e-26|46.0|139/155| RP:PDB:NREP 1 RP:PDB:REP 17->166|2d37A|3e-34|26.4|148/155| RP:PFM:NREP 1 RP:PFM:REP 28->161|PF01613|2e-17|44.8|134/150|Flavin_Reduct| HM:PFM:NREP 1 HM:PFM:REP 21->166|PF01613|5.1e-39|36.6|145/155|Flavin_Reduct| RP:SCP:NREP 1 RP:SCP:REP 17->165|1wgbA|3e-38|28.2|149/159|b.45.1.2| HM:SCP:REP 12->167|1yoaA1|6.3e-45|40.0|155/0|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 734 OP:NHOMOORG 362 OP:PATTERN ------1--------1-1-----------1-------------------------------------- --1-6--12221--43344-4411534444435444A5IE-42712-1-221762112--322-6123461-----------4-------------------------1---------------------------11112---121---11------1-111-1-----111111--1111-11-11---3--------------------------11311--------------------------------------------------------------------------------------------------------------------------------1----11------1--------1--211------2153212-1--41----------2-22-32-2-411-65573333264335221122312222221222222---1-111111111111---1111111111111------311-31111233533511113332222222625255211112111112121411111-----1111111----43-----------------------------1--------------------------------------1--------1------1------------------1---1-1111111112-121211121111222122122211--1111111111111111111112222---------------------------1---3111---1------1-4443414--12-11115323235331232-----------------------111-----------------------------------------------------------1-11-------- ------------111-----------------------------------------------------------------------------------------1--1--2-----------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 100.0 SQ:SECSTR HHHHTTTcccccccccHHHHHTTccEEcEEEEEEETTEEEEEEEcccEEEETTTTEEEEEEEGGGTTTHHHHTccEEEEEEEccHHHHHHHHHccTGGGGGTGcccEEEcGGGcEEETTEEEEEEEEEEEEEEETTEEEEEEEEEEEEccccccccEEETTEEEccEc DISOP:02AL 1-11, 166-168| PSIPRED cccccccccccccHHHHHHHHHHccccEEEEEEEcccEEEEEEEEEEEEEEccccEEEEEEcccccHHHHHHHccEEEEEEccHHHHHHHHHcccccccccccccEEccccccccEEcccEEEEEEEEEEEEEcccEEEEEEEEEEEEEccccccEEEEccEEEEccc //