[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65836.1
DDBJ      :             TfoX family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.198.5
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->106 2od0B PDBj 1e-10 33.3 %
:BLT:PDB   119->198 3bqsB PDBj 4e-08 35.0 %
:RPS:PDB   118->198 3bqsB PDBj 5e-11 34.6 %
:RPS:SCOP  12->106 2od0A1  d.198.5.2 * 9e-29 32.6 %
:RPS:PFM   12->106 PF04993 * TfoX_N 1e-14 43.5 %
:RPS:PFM   118->194 PF04994 * TfoX_C 2e-21 58.4 %
:HMM:PFM   116->194 PF04994 * TfoX_C 4.2e-29 44.3 79/81  
:HMM:PFM   13->107 PF04993 * TfoX_N 1.8e-28 36.8 95/97  
:BLT:SWISS 1->199 SXY_ECOLI 2e-88 75.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65836.1 GT:GENE ACF65836.1 GT:PRODUCT TfoX family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1167825..1168430 GB:FROM 1167825 GB:TO 1168430 GB:DIRECTION + GB:PRODUCT TfoX family protein GB:NOTE identified by match to protein family HMM PF04993; match to protein family HMM PF04994 GB:PROTEIN_ID ACF65836.1 GB:DB_XREF GI:194405617 LENGTH 201 SQ:AASEQ MRALSYDRIYKSQEYLASLGTIQYRSLFGSYSLTVEDTVFAMVANGELYLRACEESVPYCVKHPPAWLMFMKCGRPVMLNYYRVDESLWRDQQQLVRLSKYSLDAAMKEKHSRILQHRLKDLPNMTFHLETLLNESGIKDENMLRILGAKMCWLRLRQSNPLLTVKVLYALEGAIVGVHEAALPASRRQELADWAHSLTAG GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 1->199|SXY_ECOLI|2e-88|75.9|199/209| BL:PDB:NREP 2 BL:PDB:REP 9->106|2od0B|1e-10|33.3|96/99| BL:PDB:REP 119->198|3bqsB|4e-08|35.0|80/83| RP:PDB:NREP 1 RP:PDB:REP 118->198|3bqsB|5e-11|34.6|81/83| RP:PFM:NREP 2 RP:PFM:REP 12->106|PF04993|1e-14|43.5|92/96|TfoX_N| RP:PFM:REP 118->194|PF04994|2e-21|58.4|77/80|TfoX_C| HM:PFM:NREP 2 HM:PFM:REP 116->194|PF04994|4.2e-29|44.3|79/81|TfoX_C| HM:PFM:REP 13->107|PF04993|1.8e-28|36.8|95/97|TfoX_N| RP:SCP:NREP 1 RP:SCP:REP 12->106|2od0A1|9e-29|32.6|95/103|d.198.5.2| OP:NHOMO 112 OP:NHOMOORG 99 OP:PATTERN ---------------------------------------------1---------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-11111111111111111111111111111111111111111111111-1-1--111111111111--1--------------------1------111---------------------------------------12222222222222------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 88.1 SQ:SECSTR ########HHHHHHHGGGGccEEEEE#TTEEEEEETTE#EEEEETTEEEEEccHHHHHHHHHTTccccEEEETTEEEEccEEEccHHHHTcHHHHHHHHHHHHHHH###########cGGGcTTccHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHTccGGGccHHHHHHHHHHHHHH### DISOP:02AL 1-4,107-121,200-202| PSIPRED cccccHHHHHHHHHHHHHHccEEEEcccccHHEEEccEEEEEEEccEEEEEcccccHHHHHHcccHHHEEccccEEEEEEHHHccHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHcc //