[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65840.1
DDBJ      :             protein BolA
Swiss-Prot:BOLA_SHIFL   RecName: Full=Protein bolA;

Homologs  Archaea  0/68 : Bacteria  220/915 : Eukaryota  89/199 : Viruses  0/175   --->[See Alignment]
d.52.6
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->100 2dhmA PDBj 4e-52 92.0 %
:RPS:SCOP  2->86 1v9jA  d.52.6.1 * 2e-22 31.6 %
:HMM:SCOP  1->91 1v9jA_ d.52.6.1 * 1e-30 55.3 %
:RPS:PFM   11->84 PF01722 * BolA 7e-14 50.7 %
:HMM:PFM   10->85 PF01722 * BolA 5.9e-31 53.3 75/75  
:BLT:SWISS 1->105 BOLA_SHIFL 3e-54 92.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65840.1 GT:GENE ACF65840.1 GT:PRODUCT protein BolA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 548124..548441 GB:FROM 548124 GB:TO 548441 GB:DIRECTION + GB:PRODUCT protein BolA GB:NOTE identified by match to protein family HMM PF01722 GB:PROTEIN_ID ACF65840.1 GB:DB_XREF GI:194405621 LENGTH 105 SQ:AASEQ MMIREQIEEKLRTAFDPVFLEVVDESYRHNVPAGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHTYTLKEWEGLQDTIFASPPCRGAGSIA GT:EXON 1|1-105:0| SW:ID BOLA_SHIFL SW:DE RecName: Full=Protein bolA; SW:GN Name=bolA; OrderedLocusNames=SF0379, S0386; SW:KW Activator; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|BOLA_SHIFL|3e-54|92.4|105/105| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 1->100|2dhmA|4e-52|92.0|100/107| RP:PFM:NREP 1 RP:PFM:REP 11->84|PF01722|7e-14|50.7|69/71|BolA| HM:PFM:NREP 1 HM:PFM:REP 10->85|PF01722|5.9e-31|53.3|75/75|BolA| RP:SCP:NREP 1 RP:SCP:REP 2->86|1v9jA|2e-22|31.6|79/113|d.52.6.1| HM:SCP:REP 1->91|1v9jA_|1e-30|55.3|85/113|d.52.6.1|1/1|BolA-like| OP:NHOMO 330 OP:NHOMOORG 309 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--1111-11-----------------------1----1----11-1-----11-----11-11111111-----11-----------------------------1----------------------------------------------------1------------------11----1----------------------------1-----------------------------111111111111111111111111111111------11--11111111111111111111-1111111111111111111111111111111111111-11111111111-11-111111111111--11-----1111-11111111111-11111111111111111111111111111111-111---------111111111111111----------11-111--------------------------------------------------------- ----221-1---111-----------------------------------------------11--------111----------1-------1-1111-11-12--12-211111-11-111121-11311-111-1-1111111-111-1------11--1111-111111212--261112-2222-1-1111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 95.2 SQ:SECSTR ccHHHHHHHHHHHHTcccccEEEEccccccccccccccEEEEEEcGGGccccccHHHHHHHHHTHHHHHTTccccEEEEEcHHHHHTccccccccccccc##### DISOP:02AL 1-2,86-97,103-106| PSIPRED ccHHHHHHHHHHHHccccEEEEEEccHHHccccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHcccccccccccccccc //