[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65841.1
DDBJ      :             polyketide cyclase/dehydrase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  387/915 : Eukaryota  70/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->157 1t17A PDBj 3e-18 31.4 %
:RPS:PDB   15->157 2d4rC PDBj 9e-26 17.6 %
:RPS:SCOP  14->157 1t17A  d.129.3.6 * 6e-49 31.5 %
:HMM:SCOP  14->157 1t17A_ d.129.3.6 * 3.9e-33 31.5 %
:RPS:PFM   23->147 PF03364 * Polyketide_cyc 1e-32 50.4 %
:HMM:PFM   23->148 PF03364 * Polyketide_cyc 3e-35 33.3 126/130  
:BLT:SWISS 1->157 YFJG_SHIFL 2e-78 89.2 %
:PROS 137->152|PS00036|BZIP_BASIC

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65841.1 GT:GENE ACF65841.1 GT:PRODUCT polyketide cyclase/dehydrase family protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2834055..2834531) GB:FROM 2834055 GB:TO 2834531 GB:DIRECTION - GB:PRODUCT polyketide cyclase/dehydrase family protein GB:NOTE identified by match to protein family HMM PF03364 GB:PROTEIN_ID ACF65841.1 GB:DB_XREF GI:194405622 LENGTH 158 SQ:AASEQ MVLFTRFMLMGIAMPQISRTALVPYSAEQMYQLVNDVQSYPQFLPGCVGSRVLESSPAQMTAAVDVSKAGISKTFTTRNQLTRNQSILMHLVDGPFKKLIGGWKFTPLSPEACRIEFQLDFEFTNKLIELAFGRIFKELASNMVQAFTVRAKEVYRAG GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 1->157|YFJG_SHIFL|2e-78|89.2|157/158| PROS 137->152|PS00036|BZIP_BASIC|PDOC00036| BL:PDB:NREP 1 BL:PDB:REP 20->157|1t17A|3e-18|31.4|137/148| RP:PDB:NREP 1 RP:PDB:REP 15->157|2d4rC|9e-26|17.6|142/143| RP:PFM:NREP 1 RP:PFM:REP 23->147|PF03364|1e-32|50.4|125/128|Polyketide_cyc| HM:PFM:NREP 1 HM:PFM:REP 23->148|PF03364|3e-35|33.3|126/130|Polyketide_cyc| RP:SCP:NREP 1 RP:SCP:REP 14->157|1t17A|6e-49|31.5|143/148|d.129.3.6| HM:SCP:REP 14->157|1t17A_|3.9e-33|31.5|143/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 522 OP:NHOMOORG 457 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111-1111111111111111-1111111111111111111111111111111111111111111111111111212111-------111111111111111--11111111111111111111111111111-1111111111111111111111111111121111111111111111111---------------------------------------------------------11111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111-11111111111111111111111111111-111111-1-1----1111----------111111111111111111111111111111111111111111111111111111111111-------------------------------------------------------- -------------1---------1-1------------------------------------1-------------------------------1-------1-1---2-131323-2122122341317B3-325-111212222121-2--121132----3111-12---211---3----11--1-11--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 93.7 SQ:SECSTR #########ccTTccEEEEEEEEcccHHHHHHHHHcHHHHGGGcTTEEEEEEEEEETTEEEEEEEEEETEEEEEEEEEEEETTTTEEEEEEEEEcccEEEEEEEEEEETTTEEEEEEEEEEEccccccTTTcHHHHHHHHHHHHHHHHHHHHHHHHH# DISOP:02AL 158-159| PSIPRED cEEEEEEEEccccccEEEEEEEEcccHHHHHHHHHcHHHcHHHccccEEEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEEcccEEEEEEcccccHHEEEEEEEEEcccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //