[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65862.1
DDBJ      :             multidrug resistance protein MdtG
Swiss-Prot:MDTG_SALHS   RecName: Full=Multidrug resistance protein mdtG;

Homologs  Archaea  2/68 : Bacteria  220/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:404 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  22->101 1pv6A  f.38.1.2 * 2e-08 29.6 %
:RPS:SCOP  234->393 1pv6A  f.38.1.2 * 4e-04 14.5 %
:HMM:SCOP  1->400 1pv7A_ f.38.1.2 * 3.6e-75 32.1 %
:RPS:PFM   19->287 PF07690 * MFS_1 3e-11 28.2 %
:HMM:PFM   18->249 PF07690 * MFS_1 1.1e-36 33.9 227/353  
:HMM:PFM   222->391 PF07690 * MFS_1 3e-24 26.1 165/353  
:BLT:SWISS 1->404 MDTG_SALHS 0.0 100.0 %
:TM
:REPEAT 2|22->107|227->311
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65862.1 GT:GENE ACF65862.1 GT:PRODUCT multidrug resistance protein MdtG GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1245593..1246807) GB:FROM 1245593 GB:TO 1246807 GB:DIRECTION - GB:PRODUCT multidrug resistance protein MdtG GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF65862.1 GB:DB_XREF GI:194405643 LENGTH 404 SQ:AASEQ MSPSDVPINWKRNLTVTWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGLVFSITFLFSAIASPFWGGLADRKGRKIMLLRSALGMAIVMLLMGMAQNIWQFLILRALLGLLGGFIPNANALIATQVPRHKSGWALGTLSTGGVSGALLGPLAGGLLADHYGLRPVFFITASVLFICFLLTFFFIRENFLPVSKKEMLHVREVVASLKNPRLVLSLFVTTLIIQVATGSIAPILTLYVRELAGNVSNIAFISGMIASVPGVAALLSAPRLGKLGDRIGPEKILIVALIISVLLLIPMSFVQTPWQLALLRFLLGAADGALLPAVQTLLVYNSTNQIAGRIFSYNQSFRDIGNVTGPLMGAAISASYDFRAVFCVTAGVVLFNAIYSWNSLRRRRLAIE GT:EXON 1|1-404:0| SW:ID MDTG_SALHS SW:DE RecName: Full=Multidrug resistance protein mdtG; SW:GN Name=mdtG; OrderedLocusNames=SeHA_C1265; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->404|MDTG_SALHS|0.0|100.0|404/404| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 15->37| TM:REGION 52->74| TM:REGION 83->105| TM:REGION 111->133| TM:REGION 141->163| TM:REGION 172->194| TM:REGION 220->242| TM:REGION 253->275| TM:REGION 284->306| TM:REGION 323->345| TM:REGION 373->395| NREPEAT 1 REPEAT 2|22->107|227->311| SEG 109->120|lilrallgllgg| SEG 148->164|ggvsgallgplagglla| SEG 180->191|lficflltfffi| SEG 288->301|ilivaliisvllli| SEG 312->329|lallrfllgaadgallpa| RP:PFM:NREP 1 RP:PFM:REP 19->287|PF07690|3e-11|28.2|259/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 18->249|PF07690|1.1e-36|33.9|227/353|MFS_1| HM:PFM:REP 222->391|PF07690|3e-24|26.1|165/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 2 RP:SCP:REP 22->101|1pv6A|2e-08|29.6|71/417|f.38.1.2| RP:SCP:REP 234->393|1pv6A|4e-04|14.5|156/417|f.38.1.2| HM:SCP:REP 1->400|1pv7A_|3.6e-75|32.1|389/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 281 OP:NHOMOORG 224 OP:PATTERN --------------------------------------------1-1--------------------- ----------------------------------------------------------------------------------------------------------------------------------------11111----1---------------------------------------------312111111111111111111111111-21-11122222222-11111111111111-----232111112233311111211222221111---11111111111111111111111111112111-1111---12------------22---------2------1---------------------------------------11-11111--1----------1--1---11-111-------------------------------------------------------------------------------1------12------1-1-1------1----------------------------------------------------------------------1-111------------------------------------------------------------2111-1-1111111111--111111111-1111111122211--222221222222222222--1---11-1----------------------------------------------------1------1----------1--------------------------------------------------------------------------------------------------- ---------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,402-405| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccc //