[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65871.1
DDBJ      :             putative membrane protein
Swiss-Prot:YEDE_SALTY   RecName: Full=UPF0394 inner membrane protein yedE;

Homologs  Archaea  4/68 : Bacteria  153/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:401 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   113->153 PF04143 * DUF395 1.4e-12 40.0 40/43  
:HMM:PFM   290->329 PF04143 * DUF395 2.1e-14 42.5 40/43  
:BLT:SWISS 1->401 YEDE_SALTY 0.0 95.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65871.1 GT:GENE ACF65871.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2101421..2102626 GB:FROM 2101421 GB:TO 2102626 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:NOTE identified by match to protein family HMM PF04143 GB:PROTEIN_ID ACF65871.1 GB:DB_XREF GI:194405652 LENGTH 401 SQ:AASEQ MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPKLGLAMLFGIGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFTALMLIIGWEKRFFRRAGLTPAKESV GT:EXON 1|1-401:0| SW:ID YEDE_SALTY SW:DE RecName: Full=UPF0394 inner membrane protein yedE; SW:GN Name=yedE; OrderedLocusNames=STM1965; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->401|YEDE_SALTY|0.0|95.3|401/401| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 10 TM:REGION 17->39| TM:REGION 80->101| TM:REGION 115->137| TM:REGION 150->172| TM:REGION 198->217| TM:REGION 223->245| TM:REGION 256->278| TM:REGION 285->307| TM:REGION 320->342| TM:REGION 364->385| SEG 291->307|aviggllfgfgivlagg| SEG 362->383|gplggllvtylllftalmliig| HM:PFM:NREP 2 HM:PFM:REP 113->153|PF04143|1.4e-12|40.0|40/43|DUF395| HM:PFM:REP 290->329|PF04143|2.1e-14|42.5|40/43|DUF395| OP:NHOMO 170 OP:NHOMOORG 157 OP:PATTERN ------------------1-----------1-------------------------------11---- -----------------------------------------------------------------11-1-------------1------------------------------------------------------------------111---------------1--------------------11-1-----------------1--------111-1---------------------------------------------1-------------------------------------------------------11--2222222-2-----11-1-2---2------------41111-------------------------------------------------1-------------11--------1111------------------------------------------------------------------------1----------------------------------------------11------------------------------------1--1-111111-1-------1-------------------111--1111--11--------1-1------11---1-1111111111-1111111111111-11--1111----1111111111111111111111111---11111111111------------------111------------------------1111-1-1-11-11111--------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,177-192,396-402| PSIPRED ccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //