[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65883.1
DDBJ      :             iron-containing alcohol dehydrogenase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  247/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
e.22.1
:362 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->346 1kq3A PDBj 3e-36 35.2 %
:RPS:PDB   12->358 3ce9B PDBj 1e-29 13.1 %
:RPS:SCOP  7->348 1jpuA  e.22.1.2 * 1e-54 28.4 %
:HMM:SCOP  4->357 1kq3A_ e.22.1.2 * 3.2e-56 24.1 %
:RPS:PFM   89->183 PF00465 * Fe-ADH 6e-07 37.2 %
:HMM:PFM   12->348 PF00465 * Fe-ADH 3.6e-53 25.6 308/365  
:BLT:SWISS 1->361 YBDH_ECOLI e-163 82.0 %
:PROS 152->180|PS00913|ADH_IRON_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65883.1 GT:GENE ACF65883.1 GT:PRODUCT iron-containing alcohol dehydrogenase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(712106..713194) GB:FROM 712106 GB:TO 713194 GB:DIRECTION - GB:PRODUCT iron-containing alcohol dehydrogenase GB:NOTE identified by match to protein family HMM PF00465; match to protein family HMM PF01761 GB:PROTEIN_ID ACF65883.1 GB:DB_XREF GI:194405664 LENGTH 362 SQ:AASEQ MNHTEIRVVTGPANYFSHAGSLERLTDFFTPEQLSHAVWVYGERAIAAARPYLPEAFERAGAKHLPFTGHCSERHVAQLAHACNDDRQVVIGVGGGALLDTAKALARRLALPFVAIPTIAATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPRIILQAPDDYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINSACAIRDLLLTSSEQALADKQQRRLTQAFCDVVDAIIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYGILVQSALLGQDDVLAQLIAAYRRFHLPAKLSELDVDIHNTAEIDRVIAHTLRPVESIHYLPVTLTPDTLRAAFEKVEFFRI GT:EXON 1|1-362:0| BL:SWS:NREP 1 BL:SWS:REP 1->361|YBDH_ECOLI|e-163|82.0|361/362| PROS 152->180|PS00913|ADH_IRON_1|PDOC00059| TM:NTM 1 TM:REGION 109->128| SEG 239->247|gggmvgglg| BL:PDB:NREP 1 BL:PDB:REP 12->346|1kq3A|3e-36|35.2|321/364| RP:PDB:NREP 1 RP:PDB:REP 12->358|3ce9B|1e-29|13.1|327/342| RP:PFM:NREP 1 RP:PFM:REP 89->183|PF00465|6e-07|37.2|94/364|Fe-ADH| HM:PFM:NREP 1 HM:PFM:REP 12->348|PF00465|3.6e-53|25.6|308/365|Fe-ADH| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00465|IPR001670| GO:PFM GO:0046872|"GO:metal ion binding"|PF00465|IPR001670| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00465|IPR001670| RP:SCP:NREP 1 RP:SCP:REP 7->348|1jpuA|1e-54|28.4|331/361|e.22.1.2| HM:SCP:REP 4->357|1kq3A_|3.2e-56|24.1|349/0|e.22.1.2|1/1|Dehydroquinate synthase-like| OP:NHOMO 377 OP:NHOMOORG 258 OP:PATTERN -------------------------11---1-------------1----------------------- ------1------------------------------------1--------------------------1-111---2--1--------------------------1----------------1-------1------------11111111122111212111111111111111111-1----------2---------------1-221--------222111111-1----------------11--3-1-11-1-----1111-1-1--11122211111221111111111111111111111111111--111---1-22222222322----211--1---1-----------1-1------1------------------------------------------1----------------11-1----------------------------------------------------------------1----1------------------------1-----------------1-----------------------1----------------1------------1---------------------------221---------1111------1----1---------------3131-2-2222232322-223232222222222222234333112323222333332322322221112--211111111111-------------------------------------------1-------------1------------------------1--1-----------------1-------------------------------------------1---1-111--- ----21--------------------------------------------------------------------------------11-22---2-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 355 STR:RPRED 98.1 SQ:SECSTR #####ccccccccEEEEEcccGGGHHHHHHTTTccEEEEEEETTHHHHHHHHHHHHHHTTTcEEEEEEccccHHHHHHHHTTccTTccEEEEEEcHHHHHHHHHHHHHGTccEEEEEcccccGGGTccEEEEEETTEEEEEEEEEcccccEEEEEHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHcccccTTcHHHHHHHHHHHHHHHHHHHTccHHcTTcccGTTTccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHTTHHHHHHTTccHcccHHHHHHHHHHHHHcTTcccGGGcHHHHHHHHHHHHHcHHH## DISOP:02AL 1-4| PSIPRED ccccccEEEEcccEEEEcccHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccEEEEcccccccccccccEEEEcccccEEEEEEcccccEEEEEcHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHcccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccc //