[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65893.1
DDBJ      :             very short patch repair protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  177/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->156 1cw0A PDBj 8e-80 85.8 %
:RPS:PDB   2->156 1cw0A PDBj 1e-21 85.8 %
:RPS:SCOP  2->156 1cw0A  c.52.1.15 * 1e-38 85.8 %
:HMM:SCOP  2->156 1cw0A_ c.52.1.15 * 4.8e-55 49.7 %
:RPS:PFM   3->73 PF03852 * Vsr 1e-15 49.3 %
:HMM:PFM   2->74 PF03852 * Vsr 4.9e-32 45.2 73/75  
:BLT:SWISS 1->156 VSR_ECOLI 6e-80 85.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65893.1 GT:GENE ACF65893.1 GT:PRODUCT very short patch repair protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2121498..2121968) GB:FROM 2121498 GB:TO 2121968 GB:DIRECTION - GB:PRODUCT very short patch repair protein GB:NOTE identified by match to protein family HMM PF03852; match to protein family HMM TIGR00632 GB:PROTEIN_ID ACF65893.1 GB:DB_XREF GI:194405674 LENGTH 156 SQ:AASEQ MADVHDKATRSKNMRAIATRDTAIEKRLAGLLSAQGITFHTQDTTLPGKPDFVVNDYDCVIFTHGCFWHHHHCYLFKVPATRTAFWLEKIGKNVERDERDIQRLQALGWRVLIVWECALRGRAKLSDAALAERLEEWICGGGASAQIDTQGIHLLA GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 1->156|VSR_ECOLI|6e-80|85.9|156/156| BL:PDB:NREP 1 BL:PDB:REP 2->156|1cw0A|8e-80|85.8|155/155| RP:PDB:NREP 1 RP:PDB:REP 2->156|1cw0A|1e-21|85.8|155/155| RP:PFM:NREP 1 RP:PFM:REP 3->73|PF03852|1e-15|49.3|71/74|Vsr| HM:PFM:NREP 1 HM:PFM:REP 2->74|PF03852|4.9e-32|45.2|73/75|Vsr| GO:PFM:NREP 2 GO:PFM GO:0004519|"GO:endonuclease activity"|PF03852|IPR004603| GO:PFM GO:0006298|"GO:mismatch repair"|PF03852|IPR004603| RP:SCP:NREP 1 RP:SCP:REP 2->156|1cw0A|1e-38|85.8|155/155|c.52.1.15| HM:SCP:REP 2->156|1cw0A_|4.8e-55|49.7|155/155|c.52.1.15|1/1|Restriction endonuclease-like| OP:NHOMO 197 OP:NHOMOORG 181 OP:PATTERN ---------------------------------------------1---1----------------1- -21------------------------------1-1---2---------1--111-------1--------1222111--11------1----1-----------1---1-------------------111----1--11----------------------------------11--1--1---------------------------------------1---------11-------------------------1-----------------------------------------------------1----------------------------------2---111---1-----------------1112-----11--11--11-21--------------1-231--------11---1--1----1-111-11-----------111-------------------------------------1-----------1-1----1111--------1------1-1--------1--1--1----122-12-1---11--1----1-1---1---1-1------1--1--2------------------------1------1--1---1-----------------------1-------11---111111111111-1111111111111-11--1111---1-111111111111111111111111----------------11-----111-1-1----1--------------------------1-------2-1-----------------------------------1----------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 99.4 SQ:SECSTR #cccccHHHHHHHHHTccccccHHHHHHHHHHHHTTcccEEccTTcTTcccEEEGGGTEEEEEEcTTTTTcccTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEEEHHHHccTTcccHHHHHHHHHHHHHcccccEEEETTEEEEcc DISOP:02AL 1-1,4-4,9-23| PSIPRED ccccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEccccccccccEEEccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccc //