[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65897.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.38.1
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->73 2rd1B PDBj 8e-23 100.0 %
:RPS:PDB   21->68 3bduB PDBj 4e-10 51.1 %
:RPS:SCOP  23->73 2ra2A1  b.38.1.6 * 5e-16 47.1 %
:RPS:PFM   23->72 PF06004 * DUF903 2e-11 60.0 %
:HMM:PFM   23->71 PF06004 * DUF903 4.7e-26 53.1 49/50  
:HMM:PFM   1->31 PF02402 * Lysis_col 1.5e-05 33.3 30/46  
:BLT:SWISS 1->71 YGDR_SHIFL 3e-16 45.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65897.1 GT:GENE ACF65897.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1721065..1721286) GB:FROM 1721065 GB:TO 1721286 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF06004 GB:PROTEIN_ID ACF65897.1 GB:DB_XREF GI:194405678 LENGTH 73 SQ:AASEQ MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLIKAD GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 1->71|YGDR_SHIFL|3e-16|45.1|71/72| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 21->73|2rd1B|8e-23|100.0|51/56| RP:PDB:NREP 1 RP:PDB:REP 21->68|3bduB|4e-10|51.1|47/50| RP:PFM:NREP 1 RP:PFM:REP 23->72|PF06004|2e-11|60.0|50/50|DUF903| HM:PFM:NREP 2 HM:PFM:REP 23->71|PF06004|4.7e-26|53.1|49/50|DUF903| HM:PFM:REP 1->31|PF02402|1.5e-05|33.3|30/46|Lysis_col| RP:SCP:NREP 1 RP:SCP:REP 23->73|2ra2A1|5e-16|47.1|51/53|b.38.1.6| OP:NHOMO 148 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------3122-222222222-22-222222222222222222234322---322333333333333322222222--1----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 72.6 SQ:SECSTR ####################ccEEEEEETTccEEEEEcccEEcTTTcEEEEEcTTccEEEEcGGGEEEEEEcc DISOP:02AL 1-3,72-74| PSIPRED cHHHHHHHHHHHHHHHHHcccccEEEEEccccEEEEccccEEcccccEEEEEcccccEEEEcHHHHEEEEEcc //