[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65921.1
DDBJ      :             cytochrome bd-II oxidase subunit 1
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  612/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:467 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->436 PF01654 * Bac_Ubq_Cox e-108 49.6 %
:HMM:PFM   8->437 PF01654 * Bac_Ubq_Cox 6.7e-175 48.2 427/436  
:BLT:SWISS 8->437 CYDA_BACSU 2e-80 36.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65921.1 GT:GENE ACF65921.1 GT:PRODUCT cytochrome bd-II oxidase subunit 1 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 455892..457295 GB:FROM 455892 GB:TO 457295 GB:DIRECTION + GB:PRODUCT cytochrome bd-II oxidase subunit 1 GB:NOTE identified by match to protein family HMM PF01654 GB:PROTEIN_ID ACF65921.1 GB:DB_XREF GI:194405702 LENGTH 467 SQ:AASEQ MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTRNPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNGQVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMALWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAERTRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGLASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVSAHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVGESLEQEKRE GT:EXON 1|1-467:0| BL:SWS:NREP 1 BL:SWS:REP 8->437|CYDA_BACSU|2e-80|36.4|429/468| TM:NTM 9 TM:REGION 12->34| TM:REGION 55->77| TM:REGION 94->116| TM:REGION 127->149| TM:REGION 184->206| TM:REGION 218->240| TM:REGION 321->343| TM:REGION 359->381| TM:REGION 409->431| RP:PFM:NREP 1 RP:PFM:REP 8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox| HM:PFM:NREP 1 HM:PFM:REP 8->437|PF01654|6.7e-175|48.2|427/436|Bac_Ubq_Cox| GO:PFM:NREP 3 GO:PFM GO:0016020|"GO:membrane"|PF01654|IPR002585| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01654|IPR002585| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01654|IPR002585| OP:NHOMO 970 OP:NHOMOORG 625 OP:PATTERN -------------------------421-1--------------------11-----1---222---- 11111-11111--111111-11--1211111-11112111111111111111111-11--11111122112--------111-11-111111-111----11-1-1-1-111111111111111111-11-11-11--------2-1111---1111-------11141---------------1------12233333333233333312222233312111111111112-111111111111111111111-1-22-11-1111122-1-1111111111---------------------------------------1----------------------------2--1-11-1----11--------111111-----122111-11113111111111111-33234133211-3111-111111133-1-11111111--2222222221111-31------------11111111111111-1---12-1333233332333222255543433124542222-1112-1---11111-11--2-211----------12--1211111121111121211111122221113111-111111--1--------111-11221311211121222211221221121211--1-11-------23122322222222222-2222222222222222222332223233333333333333232222222221-211111111111---12222122221111311111111111111122222121112111212222112112111211112121-111133333122112234344333-------------------------------------------------------------11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,434-468| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccEEEEccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccEEEEEEEEccccEEEEEEEcccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHcc //