[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65947.1
DDBJ      :             hydrogenase-1 operon protein HyaF2
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  114/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.1.4g.41.5
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   298->341 2dsxA PDBj 2e-10 54.5 %
:RPS:PDB   295->346 1brfA PDBj 6e-15 40.4 %
:RPS:SCOP  165->278 1vhnA  c.1.4.1 * 6e-05 18.8 %
:RPS:SCOP  296->346 1b13A  g.41.5.1 * 4e-13 37.3 %
:HMM:SCOP  294->346 1qcvA_ g.41.5.1 * 4.5e-17 50.9 %
:RPS:PFM   72->147 PF04809 * HupH_C 9e-14 48.1 %
:RPS:PFM   182->271 PF04809 * HupH_C 1e-25 53.3 %
:RPS:PFM   295->341 PF00301 * Rubredoxin 3e-11 57.4 %
:HMM:PFM   84->146 PF04809 * HupH_C 2e-10 34.4 61/120  
:HMM:PFM   166->282 PF04809 * HupH_C 9.2e-45 49.6 117/120  
:HMM:PFM   295->341 PF00301 * Rubredoxin 1.4e-21 59.6 47/47  
:BLT:SWISS 3->282 HOXQ_RALEH 6e-44 39.6 %
:BLT:SWISS 296->345 RUBR_AZOVI 6e-17 60.0 %
:REPEAT 2|64->145|181->259
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65947.1 GT:GENE ACF65947.1 GT:PRODUCT hydrogenase-1 operon protein HyaF2 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1656030..1657091) GB:FROM 1656030 GB:TO 1657091 GB:DIRECTION - GB:PRODUCT hydrogenase-1 operon protein HyaF2 GB:NOTE identified by match to protein family HMM PF00301; match to protein family HMM PF04809 GB:PROTEIN_ID ACF65947.1 GB:DB_XREF GI:194405728 LENGTH 353 SQ:AASEQ MNHSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVATLPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNADQQRVADEIIIGPIPESIWQTHPQPPITPELPPQPAGLMNGAFIAHEIAERVKQPVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLEWLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEGNNSCKD GT:EXON 1|1-353:0| BL:SWS:NREP 2 BL:SWS:REP 3->282|HOXQ_RALEH|6e-44|39.6|273/282| BL:SWS:REP 296->345|RUBR_AZOVI|6e-17|60.0|50/72| NREPEAT 1 REPEAT 2|64->145|181->259| SEG 152->164|pqppitpelppqp| BL:PDB:NREP 1 BL:PDB:REP 298->341|2dsxA|2e-10|54.5|44/52| RP:PDB:NREP 1 RP:PDB:REP 295->346|1brfA|6e-15|40.4|52/53| RP:PFM:NREP 3 RP:PFM:REP 72->147|PF04809|9e-14|48.1|73/108|HupH_C| RP:PFM:REP 182->271|PF04809|1e-25|53.3|90/108|HupH_C| RP:PFM:REP 295->341|PF00301|3e-11|57.4|47/47|Rubredoxin| HM:PFM:NREP 3 HM:PFM:REP 84->146|PF04809|2e-10|34.4|61/120|HupH_C| HM:PFM:REP 166->282|PF04809|9.2e-45|49.6|117/120|HupH_C| HM:PFM:REP 295->341|PF00301|1.4e-21|59.6|47/47|Rubredoxin| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00301|IPR004039| GO:PFM GO:0046872|"GO:metal ion binding"|PF00301|IPR004039| RP:SCP:NREP 2 RP:SCP:REP 165->278|1vhnA|6e-05|18.8|101/305|c.1.4.1| RP:SCP:REP 296->346|1b13A|4e-13|37.3|51/54|g.41.5.1| HM:SCP:REP 294->346|1qcvA_|4.5e-17|50.9|53/53|g.41.5.1|1/1|Rubredoxin-like| OP:NHOMO 213 OP:NHOMOORG 122 OP:PATTERN ----------------1------1------------1----------1----------------1--- -------------------------------------------------------------------------------------111---1------------------------------------12----------------11-----11-----1----1---1---1--------------1------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------2-322---222-2------------------------------------22-----22222-----------2------1------------------------------------------------------1-------2---22------1----2------------------------22-----------------1--11--------1--------------------------------------------------------------2--------1--121-2221222222-2222222221222222222111-----3323333332233333-2213222---------------------------1-----------------------------2------------------------------------------------------------------------------------------------------11---111-11-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 19.5 SQ:SECSTR #####################################################################################################################################################################################################################################################################################cccccccccccccccccEEEETTTccEEETTTccGGGTccTTccGGGccTTcccTTTcccGGGEEEccc####### DISOP:02AL 1-3,348-354| PSIPRED cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHcccccEEEEEEcccccEEEEEEEHHccEEEEEEEcccccEEEEEEEEEHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHccccEEEEEEcccEEEEcccccccEEEEEEEcccccEEEEEEEEEcHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHcEEEEccccEEEccccccccccccccccHHHcccccccccccccHHHEEEcccccccccc //