[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65948.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->31 PF08085 * Entericidin 6.6e-05 52.6 19/42  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65948.1 GT:GENE ACF65948.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1343574..1343732) GB:FROM 1343574 GB:TO 1343732 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF65948.1 GB:DB_XREF GI:194405729 LENGTH 52 SQ:AASEQ MLTPPGLVMIFLAVLFSLLTGCASYKNTAWGIYPASTDICPSGTTSTGGCKE GT:EXON 1|1-52:0| TM:NTM 1 TM:REGION 2->24| HM:PFM:NREP 1 HM:PFM:REP 9->31|PF08085|6.6e-05|52.6|19/42|Entericidin| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,46-53| PSIPRED cccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc //