[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65949.1
DDBJ      :             manganese transport protein MntH
Swiss-Prot:MNTH_SALTI   RecName: Full=Manganese transport protein mntH;

Homologs  Archaea  11/68 : Bacteria  397/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
:392 amino acids
:PSIPRED
:RPS:PFM   18->360 PF01566 * Nramp 1e-65 47.5 %
:HMM:PFM   17->363 PF01566 * Nramp 1.4e-130 48.6 346/356  
:BLT:SWISS 1->392 MNTH_SALTI 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65949.1 GT:GENE ACF65949.1 GT:PRODUCT manganese transport protein MntH GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2581522..2582700) GB:FROM 2581522 GB:TO 2582700 GB:DIRECTION - GB:PRODUCT manganese transport protein MntH GB:NOTE identified by match to protein family HMM PF01566; match to protein family HMM TIGR01197 GB:PROTEIN_ID ACF65949.1 GB:DB_XREF GI:194405730 LENGTH 392 SQ:AASEQ MGPAFIAAIGYIDPGNFATNIQAGASFGYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEIIAMATDLAEFIGAAIGFKLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLFVAAAYIVELFFSQPDMAQLGKGMVIPALPNPEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGTRQQRYSATKWDVAIAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYLTLEPLLSHAAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITMLPSFIVILMGLDPTRILVMSQVLLSFGIALALVPLLIFTSNATLMGELVNTRRVKQIGWIIVVLVVALNIWLLVGTVMGLS GT:EXON 1|1-392:0| SW:ID MNTH_SALTI SW:DE RecName: Full=Manganese transport protein mntH; SW:GN Name=mntH; OrderedLocusNames=STY2649, t0449; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Manganese;Membrane; Symport; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|MNTH_SALTI|0.0|100.0|392/413| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015293|"GO:symporter activity"|Symport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 10 TM:REGION 33->55| TM:REGION 72->94| TM:REGION 102->124| TM:REGION 141->163| TM:REGION 176->198| TM:REGION 217->239| TM:REGION 255->277| TM:REGION 282->304| TM:REGION 321->343| TM:REGION 368->390| SEG 231->239|ammataaaa| RP:PFM:NREP 1 RP:PFM:REP 18->360|PF01566|1e-65|47.5|341/354|Nramp| HM:PFM:NREP 1 HM:PFM:REP 17->363|PF01566|1.4e-130|48.6|346/356|Nramp| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01566|IPR001046| GO:PFM GO:0006810|"GO:transport"|PF01566|IPR001046| GO:PFM GO:0016020|"GO:membrane"|PF01566|IPR001046| OP:NHOMO 986 OP:NHOMOORG 578 OP:PATTERN ------1--1----11-1-11---1------1-1-----------------------------1---- 2251-1----121-13311-111122111112-111-122----1----11122---1-----11------1111111112-1-----1111-1-----1-21111-2-2----------------1------2--1--------1----------------------12--------------11--11-3-11111111111111111-1111111-1-111-111111-111111111111111-111122-3-34-1--1332222213113132211----111---------------------------111----2--43----------1-------------------1----12-2322---1-2---2-----12324111211-111111111111-1311221111--211112-112-11--------------1111111121111----------------------------------1---1----44445332333443533332334411----211-1---1--121------21----------------1-1----2---1-11-1--1-1------11------------------------1--11-1----21-------------------11------------11111111111111111-111111111111111111112111---111111111111111121111111111111111-111111-1------------1----------------------------2212-111------111---------1---------1----11111111111111--------------------------------------------------------11- 11--222-1---11211--11111111------1111111111---1211121111-1-22223333323333333313333443411-22211111111151342-13-43521-32222222252826P2-6371322222612222222232212211--221-31-12411343181111269E9177-146342 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHEEccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //