[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65951.1
DDBJ      :             putative transport protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  327/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:210 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->202 PF01810 * LysE 7e-14 29.8 %
:HMM:PFM   18->206 PF01810 * LysE 1.4e-53 28.0 189/192  
:BLT:SWISS 1->210 YAHN_ECOLI 2e-91 77.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65951.1 GT:GENE ACF65951.1 GT:PRODUCT putative transport protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(461939..462571) GB:FROM 461939 GB:TO 462571 GB:DIRECTION - GB:PRODUCT putative transport protein GB:NOTE identified by match to protein family HMM PF01810; match to protein family HMM TIGR00949 GB:PROTEIN_ID ACF65951.1 GB:DB_XREF GI:194405732 LENGTH 210 SQ:AASEQ MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGLGVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQTPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIWRIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->210|YAHN_ECOLI|2e-91|77.1|210/223| TM:NTM 5 TM:REGION 9->31| TM:REGION 62->84| TM:REGION 119->140| TM:REGION 149->171| TM:REGION 185->207| SEG 7->19|vvltvslfvltff| RP:PFM:NREP 1 RP:PFM:REP 21->202|PF01810|7e-14|29.8|181/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 18->206|PF01810|1.4e-53|28.0|189/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 752 OP:NHOMOORG 330 OP:PATTERN ------------------------1-----------------1------------------------- ----22112221-1-----------------------1--------------------------1-1--1--------------------------1------------1--------------------------1-------1--------------------------------------------------1-112-211-1-1--311-1112-321---------3----------------11111---------------------------------------------------------------------------------------------------------------------------222-111-1--2---------122112112115--1-1121115--6557425436542-1---32111-3----------2----------------------------------------------38896791222266462221219432133--323--1--1-2122--2--1-11----------11--11-313-1-1--1--1-111-2-----1-----1-------1----------1-----14111-3-3122212223322111222112-------------32631123323333333-33233333333323323333433413133333333333333335111--121-422222222222---1-----1211-1326222211-111111-1444642311---331216331221222121---------24553343334511----------1111---------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 93-113,209-211| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //