[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65952.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   52->83 PF08700 * Vps51 5.4e-05 21.9 32/87  
:HMM:PFM   31->53 PF08845 * DUF1813 0.00026 30.4 23/57  
:BLT:SWISS 35->84 GATB1_CLOAB 7e-04 44.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65952.1 GT:GENE ACF65952.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(346859..347122) GB:FROM 346859 GB:TO 347122 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF65952.1 GB:DB_XREF GI:194405733 LENGTH 87 SQ:AASEQ MNASGASVRHINSETCMTTCYSQIPSGDCQEEAGFETGASVVVKISERGLILIAETDEVRDLRKELYQVKKSMKHIKAGVNNVVNGN GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 35->84|GATB1_CLOAB|7e-04|44.0|50/476| HM:PFM:NREP 2 HM:PFM:REP 52->83|PF08700|5.4e-05|21.9|32/87|Vps51| HM:PFM:REP 31->53|PF08845|0.00026|30.4|23/57|DUF1813| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111----1----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,65-70,72-73,85-88| PSIPRED cccccccEEHHHHHHHHHHHHHHcccHHHHHHHHHccccEEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //