[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65987.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.371.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   49->175 2joeA PDBj 9e-19 33.1 %
:RPS:SCOP  50->175 2joeA1  d.371.1.1 * 4e-16 32.5 %
:RPS:PFM   52->172 PF06998 * DUF1307 3e-19 43.0 %
:HMM:PFM   52->173 PF06998 * DUF1307 6.6e-46 42.6 122/123  
:HMM:PFM   11->38 PF06291 * Lambda_Bor 0.00069 42.9 28/97  
:BLT:SWISS 44->176 Y207_LISMO 1e-25 38.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65987.1 GT:GENE ACF65987.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2300231..2300761 GB:FROM 2300231 GB:TO 2300761 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06998 GB:PROTEIN_ID ACF65987.1 GB:DB_XREF GI:194405768 LENGTH 176 SQ:AASEQ MQVLRLMALPLFALSLSVSITGCDQKNDTLQGKQNNMTAFIKKIAASKESEETQRYVGNLNGIEIKLTYYYKGDIVLRQISEHKLLYKTLKANNKEEAQKMLSQVGEAYQGMPGLTERIDYYDSYATEYVDIDFTQAKISDLCKLPGSSIDNCSAYYLSMIRSQKLLEESGYHRIN GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 44->176|Y207_LISMO|1e-25|38.3|133/153| BL:PDB:NREP 1 BL:PDB:REP 49->175|2joeA|9e-19|33.1|127/139| RP:PFM:NREP 1 RP:PFM:REP 52->172|PF06998|3e-19|43.0|121/123|DUF1307| HM:PFM:NREP 2 HM:PFM:REP 52->173|PF06998|6.6e-46|42.6|122/123|DUF1307| HM:PFM:REP 11->38|PF06291|0.00069|42.9|28/97|Lambda_Bor| RP:SCP:NREP 1 RP:SCP:REP 50->175|2joeA1|4e-16|32.5|126/130|d.371.1.1| OP:NHOMO 75 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111-------------------11--1--------------------------------111------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-111111111-111111111--------2-12222222122222-1-11111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 72.2 SQ:SECSTR ################################################ccEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEETTTcccccHHHHHHHHHHHHTTTTTccccEEEEEEcccEEEEEEEEETTcccHHHHTTTTccTTcHHHHHHccHHHHHHHHHHTTccEE# DISOP:02AL 1-1,103-106,108-108,148-150,173-177| PSIPRED ccHHHHHHHHHEEEEEEEEEEEccccccccccccccEEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEccEEEEEEEEEEEEHHHHccccHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEEEHHHccHHHHHccccccccccccccEEHHHHHHHHHHccccccc //