[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF65995.1
DDBJ      :             glucitol operon activator protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->109 PF06923 * GutM 9e-30 56.5 %
:HMM:PFM   3->110 PF06923 * GutM 1.1e-40 44.4 108/109  
:BLT:SWISS 1->119 GUTM_ECOLI 7e-45 82.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65995.1 GT:GENE ACF65995.1 GT:PRODUCT glucitol operon activator protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2955591..2955950 GB:FROM 2955591 GB:TO 2955950 GB:DIRECTION + GB:PRODUCT glucitol operon activator protein GB:NOTE identified by match to protein family HMM PF06923 GB:PROTEIN_ID ACF65995.1 GB:DB_XREF GI:194405776 LENGTH 119 SQ:AASEQ MVSTLITVAVIAWCAQLALGGWQISRFNRAFDKLSQQGRVGVGRSGGRFKPRVVVAVALDEQQRVTDTLLMKGLTVFARPVKIAAMQGKHLHELQPDVIFPHDSLAQNALSLALKLKHG GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 1->119|GUTM_ECOLI|7e-45|82.4|119/100| TM:NTM 1 TM:REGION 1->23| SEG 35->48|sqqgrvgvgrsggr| RP:PFM:NREP 1 RP:PFM:REP 2->109|PF06923|9e-30|56.5|108/109|GutM| HM:PFM:NREP 1 HM:PFM:REP 3->110|PF06923|1.1e-40|44.4|108/109|GutM| OP:NHOMO 61 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12----------------------------------------1------1111111111-11111-111111111111--11-----11111111111111111-111111--1--------------------------------1--------111------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,119-120| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccEEEEEEEccccHHHHHHHHcccEEEEEEEEcHHHccccHHHHcHHHHccccHHHHHHHHHHHHHccc //