[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66011.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66011.1 GT:GENE ACF66011.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2040065..2040757) GB:FROM 2040065 GB:TO 2040757 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF66011.1 GB:DB_XREF GI:194405792 LENGTH 230 SQ:AASEQ MVDDKPMRIGWVFYFSYIFVAIIFHLFISFCYCLSIDMAEANTVVFLLKPGTISLLFLLLPARRFRTRLLATLSSVFITLVFNQWHLVAGNKELVLCLQAACFMAFLAITSVKKSGWMISASLFLVCAAGTIRQCWLEQLFNAADIYIVNDGRSCGASGHCFQYIAAKGRGLAAKRQALFSSEEYVNIYYSYSEVMPAVNFDGMKNEFVQYLLCHGELKSVARDDKTTCD GT:EXON 1|1-230:0| TM:NTM 5 TM:REGION 10->32| TM:REGION 37->59| TM:REGION 68->86| TM:REGION 91->112| TM:REGION 115->137| SEG 55->73|llflllparrfrtrllatl| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111--1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,226-226,228-231| PSIPRED cccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccEEHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHccHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHccccHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccc //