[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66015.1
DDBJ      :             invasion protein IagB
Swiss-Prot:IAGB_SALTY   RecName: Full=Invasion protein iagB;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.2.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->68 1jugA PDBj 2e-04 55.2 %
:RPS:PDB   18->133 132lA PDBj 6e-22 20.9 %
:RPS:SCOP  17->151 1qsaA2  d.2.1.6 * 8e-17 26.2 %
:HMM:SCOP  8->152 1lsgA1 d.2.1.2 * 3.2e-35 36.4 %
:RPS:PFM   24->128 PF01464 * SLT 1e-09 37.0 %
:HMM:PFM   20->138 PF01464 * SLT 1.5e-39 37.8 119/121  
:BLT:SWISS 1->160 IAGB_SALTY 2e-91 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66015.1 GT:GENE ACF66015.1 GT:PRODUCT invasion protein IagB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2996049..2996531 GB:FROM 2996049 GB:TO 2996531 GB:DIRECTION + GB:PRODUCT invasion protein IagB GB:NOTE identified by match to protein family HMM PF01464 GB:PROTEIN_ID ACF66015.1 GB:DB_XREF GI:194405796 LENGTH 160 SQ:AASEQ MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK GT:EXON 1|1-160:0| SW:ID IAGB_SALTY SW:DE RecName: Full=Invasion protein iagB;Flags: Precursor; SW:GN Name=iagB; OrderedLocusNames=STM2877; SW:KW Complete proteome; Signal; Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->160|IAGB_SALTY|2e-91|100.0|160/160| GO:SWS:NREP 1 GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| BL:PDB:NREP 1 BL:PDB:REP 40->68|1jugA|2e-04|55.2|29/125| RP:PDB:NREP 1 RP:PDB:REP 18->133|132lA|6e-22|20.9|115/124| RP:PFM:NREP 1 RP:PFM:REP 24->128|PF01464|1e-09|37.0|100/113|SLT| HM:PFM:NREP 1 HM:PFM:REP 20->138|PF01464|1.5e-39|37.8|119/121|SLT| RP:SCP:NREP 1 RP:SCP:REP 17->151|1qsaA2|8e-17|26.2|130/168|d.2.1.6| HM:SCP:REP 8->152|1lsgA1|3.2e-35|36.4|140/144|d.2.1.2|1/1|Lysozyme-like| OP:NHOMO 187 OP:NHOMOORG 110 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------12-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------423334422214422222212341--11--542-1-2--121---------1--1--------2-2----------1----1-13-1--3------1-----1-----1-----------------1-----------------------------------------1----11-22--1-1---21-3131112211------2--1----2111111121122211--111--12-2--------2----4--------------------------------1----------------1------2------------1------------1--11211111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 93.1 SQ:SECSTR ccccGGGccccccccHHHHHHHHTTcTTcTTccHHHHHHHHHHHTTcTTcEEEcTTccEEETTTTEETTTTccccccTTcccTTcGccGGGGGccccHHHHHHHHHHHTccGGGGcHHHHHHTTccGGGGGTTHHTTTcTTcccccHHH########### DISOP:02AL 1-1,149-153,156-161| PSIPRED ccHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEccccccccEEEEEEcHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHccccEEHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHccccccccc //