[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66028.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->119 1s4kA PDBj 5e-60 99.1 %
:RPS:SCOP  7->119 1s4kA  a.35.1.6 * 1e-11 96.5 %
:HMM:SCOP  1->119 1s4kA_ a.35.1.6 * 3.7e-42 47.9 %
:RPS:PFM   2->119 PF08965 * DUF1870 3e-42 66.1 %
:HMM:PFM   2->119 PF08965 * DUF1870 4e-61 55.9 118/118  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66028.1 GT:GENE ACF66028.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1449496..1449855) GB:FROM 1449496 GB:TO 1449855 GB:DIRECTION - GB:PRODUCT putative cytoplasmic protein GB:NOTE identified by match to protein family HMM PF08965 GB:PROTEIN_ID ACF66028.1 GB:DB_XREF GI:194405809 LENGTH 119 SQ:AASEQ MMNALELQALRRIFDMTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEMKAKRQRRINAIVDKINNRIGNNTMRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC GT:EXON 1|1-119:0| BL:PDB:NREP 1 BL:PDB:REP 3->119|1s4kA|5e-60|99.1|114/115| RP:PFM:NREP 1 RP:PFM:REP 2->119|PF08965|3e-42|66.1|118/118|DUF1870| HM:PFM:NREP 1 HM:PFM:REP 2->119|PF08965|4e-61|55.9|118/118|DUF1870| RP:SCP:NREP 1 RP:SCP:REP 7->119|1s4kA|1e-11|96.5|113/120|a.35.1.6| HM:SCP:REP 1->119|1s4kA_|3.7e-42|47.9|119/0|a.35.1.6|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1111111-11-1111111111111111111--------1-1-1111111-1--1-1-11111-----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 95.8 SQ:SECSTR ##cHHHHHHHHHHTT#cHHHHHHHTcccccHHHHHHHHHTcccccHHHHHHHHH#HHHHHHHHHHHHHHHTTcccccE#cccccHHHHHTTcTTccHHHHHHHHHHHHHHHHTTccEEc DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHc //