[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66032.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   52->216 PF06884 * DUF1264 4e-64 65.5 %
:HMM:PFM   51->217 PF06884 * DUF1264 1.6e-76 55.1 167/171  
:HMM:PFM   234->247 PF02817 * E3_binding 0.00063 50.0 14/39  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66032.1 GT:GENE ACF66032.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1691481..1692266) GB:FROM 1691481 GB:TO 1692266 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06884 GB:PROTEIN_ID ACF66032.1 GB:DB_XREF GI:194405813 LENGTH 261 SQ:AASEQ MKILPLALFIIPFLAGCGANNTPPQTPIPGEKTSAKLRTLETGAAAIQSRPPVDAISTYLDGFHFYSGDKNGQMEAHHYVTVLNEDVMQAVIYDGNTKNARLMGVEYIISERLFKTLPPEEKKLWHSHQYEVKSGSLVAPGLPQVADKALMSKIVNTYGKTWHTWHTDRDKTLPMGIPALMMGFTGDGQLAPALLADRDRRLGIDTRAIKRERQDLPEHPVVKGANAWEQGEVIQLQRVQGSGEHGRGDTAHFGTSEQSRQ GT:EXON 1|1-261:0| TM:NTM 1 TM:REGION 1->21| SEG 3->15|ilplalfiipfla| RP:PFM:NREP 1 RP:PFM:REP 52->216|PF06884|4e-64|65.5|165/171|DUF1264| HM:PFM:NREP 2 HM:PFM:REP 51->217|PF06884|1.6e-76|55.1|167/171|DUF1264| HM:PFM:REP 234->247|PF02817|0.00063|50.0|14/39|E3_binding| OP:NHOMO 111 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------1-----------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------11-------------------1--------------------------------------------------------------------------1----------1-------------------------------------------1111111111111111----------------------------------------------------------------------------1-1-11-1--------------------------11111------------------------------------------------------------------ --------------111111111-11111-------1111111---1111111111111111---------------------------121111-111--111-1---1------------------------------------------------------------------1------113362152------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,19-33,210-219,253-262| PSIPRED ccEEHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccHHHHHcccHHHHHcccccccEEEccEEEcccccHHHHHHHHHHHHHHcccEEEEEEccccccccccccHHHcccccHHHccHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccEEEEEEccccccccccccHHccccHHHcc //