[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66037.1
DDBJ      :             phage minor tail protein L
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  8/175   --->[See Alignment]
:231 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->228 PF05100 * Phage_tail_L 4e-71 59.5 %
:HMM:PFM   29->230 PF05100 * Phage_tail_L 2.4e-96 54.5 202/206  
:BLT:SWISS 1->231 VMTL_LAMBD 3e-94 66.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66037.1 GT:GENE ACF66037.1 GT:PRODUCT phage minor tail protein L GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1135579..1136274 GB:FROM 1135579 GB:TO 1136274 GB:DIRECTION + GB:PRODUCT phage minor tail protein L GB:NOTE identified by match to protein family HMM PF05100; match to protein family HMM TIGR01600 GB:PROTEIN_ID ACF66037.1 GB:DB_XREF GI:194405818 LENGTH 231 SQ:AASEQ MQDIPQETLSETTKAEQSAKVDLWEFDLTAIGGERFFFCNEPNEKGEPLTWQGRQYEPYPIQVQDFEMNGKGASPRPNLVVANLFGLVTGMAEDLQSLVGASVVRHQVYSKFLDAVNFSNGNPGADPEQEAVARYNVEQLSELDSSTATIILASPAETDGSVVPGRTMLADSCPWDYRDENCGYDGPPVADEFDKPTSDPKKDKCSHCMKGCEMRNNLVNAGFFASINKLS GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 1->231|VMTL_LAMBD|3e-94|66.7|231/232| RP:PFM:NREP 1 RP:PFM:REP 29->228|PF05100|4e-71|59.5|200/205|Phage_tail_L| HM:PFM:NREP 1 HM:PFM:REP 29->230|PF05100|2.4e-96|54.5|202/206|Phage_tail_L| OP:NHOMO 182 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7----------------------------------------------------------------------------------------------------11-1-1---1-----------1------------------------1-1-------------------------------------1------------------------------------------1------1-1-------------------1---1--AA3-314---B1-4135144A44111-11-1---1-1--1-12121-113--2-23-21222-1221-2222--1------------------1-111------2-----1----1----112-12-1----1---1------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------1---------------------------------------------------------------------1---------------------------1111---1-1---------------------- DISOP:02AL 1-5,8-8,68-76| PSIPRED cccccHHHHHHHHHcccccEEEEEEEEEEEccccEEEEEccccccccEEEEEccEEccEEEEEEEEEEcccccccccEEEEEEHHHHHHHHHHHHccccEEEEEEEEEEHHHHHccccccccccccccccEEEEEEEEccccccccEEEEEEccHHHccccccccEEEEEcccEEEEcccccccccccEEcccccccccHHHcccccEEEEEEccccccccccEEEEHccc //