[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66055.1
DDBJ      :             MscS Mechanosensitive ion channel
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  421/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
b.38.1d.58.43f.34.1
:377 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   141->328 2vv5A PDBj 3e-09 26.1 %
:RPS:SCOP  135->184 2oauA3  f.34.1.1 * 5e-06 30.0 %
:RPS:SCOP  187->250 2oauA1  b.38.1.3 * 2e-13 29.7 %
:RPS:SCOP  252->351 2oauA2  d.58.43.1 * 4e-14 18.6 %
:HMM:SCOP  97->184 2oauA3 f.34.1.1 * 8.8e-13 30.2 %
:HMM:SCOP  185->251 2oauA1 b.38.1.3 * 6.9e-15 37.3 %
:HMM:SCOP  252->355 2oauA2 d.58.43.1 * 2.5e-11 26.5 %
:RPS:PFM   144->343 PF00924 * MS_channel 4e-29 37.1 %
:HMM:PFM   143->344 PF00924 * MS_channel 9.4e-56 36.1 202/207  
:HMM:PFM   17->49 PF05552 * TM_helix 0.00018 15.2 33/53  
:BLT:SWISS 159->347 Y1143_METJA 9e-22 29.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66055.1 GT:GENE ACF66055.1 GT:PRODUCT MscS Mechanosensitive ion channel GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1349031..1350164) GB:FROM 1349031 GB:TO 1350164 GB:DIRECTION - GB:PRODUCT MscS Mechanosensitive ion channel GB:NOTE identified by match to protein family HMM PF00924 GB:PROTEIN_ID ACF66055.1 GB:DB_XREF GI:194405836 LENGTH 377 SQ:AASEQ MEYLARLNIVAMLMSTTFWINLAVVFFVTLITYWLINWLLNVVYKALQRPDKKDDAHGRLRPIVFEMLKKTSKMLIFFAAFLFSLRFVALPDRLFSTLSHAWFLVVAIQMAIWLDQGVQSWMRHLLYAPGSNKNPVTLVILGMILRVLVWSMMLLSILANVGVDITALVASLGVGGIAIALAVQTVLSDVFASLSIGFDKPFEIGDFVVFNDVAGTIEHIGLKTTRIRSLSGEQIVCANAQLLQQTIHNYKRMQTRRIVFTFGVATATPPEKLRLIGDMVKKIITDVGETQFDRAHLLAFGQDRLTYEVVHIVNTADYNKYMDIQQEINIRIIEKLIENDIELALPSLVVRAPVQVEETRDYSNTADAKNADKRVMQ GT:EXON 1|1-377:0| BL:SWS:NREP 1 BL:SWS:REP 159->347|Y1143_METJA|9e-22|29.6|189/361| TM:NTM 5 TM:REGION 15->37| TM:REGION 71->93| TM:REGION 99->121| TM:REGION 136->158| TM:REGION 171->193| BL:PDB:NREP 1 BL:PDB:REP 141->328|2vv5A|3e-09|26.1|180/256| RP:PFM:NREP 1 RP:PFM:REP 144->343|PF00924|4e-29|37.1|197/203|MS_channel| HM:PFM:NREP 2 HM:PFM:REP 143->344|PF00924|9.4e-56|36.1|202/207|MS_channel| HM:PFM:REP 17->49|PF05552|0.00018|15.2|33/53|TM_helix| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00924|IPR006685| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00924|IPR006685| RP:SCP:NREP 3 RP:SCP:REP 135->184|2oauA3|5e-06|30.0|50/86|f.34.1.1| RP:SCP:REP 187->250|2oauA1|2e-13|29.7|64/67|b.38.1.3| RP:SCP:REP 252->351|2oauA2|4e-14|18.6|97/101|d.58.43.1| HM:SCP:REP 97->184|2oauA3|8.8e-13|30.2|86/0|f.34.1.1|2/2|Mechanosensitive channel protein MscS (YggB), transmembrane region| HM:SCP:REP 185->251|2oauA1|6.9e-15|37.3|67/0|b.38.1.3|1/1|Sm-like ribonucleoproteins| HM:SCP:REP 252->355|2oauA2|2.5e-11|26.5|98/0|d.58.43.1|1/1|Mechanosensitive channel protein MscS (YggB), C-terminal domain| OP:NHOMO 684 OP:NHOMOORG 463 OP:PATTERN ---131------------------2222-222-11221222221-2-1-2----1-1-111----2-- -11--------------------------------------2-11-------1111-1--11-11---1--1---111-1---111-1--12-1--2---12-1112-21---------------21---111-22--------1-443232-1-111212-1421311111-11111-11111---------1---------------111111------1-111111111-111111111111111---1---1------1-1111----1--------------------------------------------------------------1-1-1--1111-----111--111-1111-1111--111-2---1-----1--------1111----------1-11111-1-11--211-13-321--1-2312112122311--------1---------------------------------------211----1-11-1---------1------21--1----1112-111---11112-11---1-------1-11-1222211-1--1--11111222232111123-1-1121------11111111122212--33-2212111-3122213311113132123---21--1-----12---112222222222-2222222222222222222-1-11--33323333333333333-2222221--111111111111---123223--1111111---1-1------1111111111--22-----212-21-112222---------232231211224432--------------1--1------111-11-1--1------------------------------------11 ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----11---2--2--1---1-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 47.7 SQ:SECSTR ############################################################################################################################################HHHHHHHHHHHHHHHHHHHTTTcccTTHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHTTccccTTcEEEccccEEEEEEEcccEEEEEcTTccEEEEEHHHHHTcccEEcccccEEEEEEEEEEcTTccH#######HHHHHHHHHHHHHc#TTEEEEEEccccEEEEEEEEEETTTHHHHHHHHHHH################################################# DISOP:02AL 1-1,352-378| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccEEEEEEEEEEEEEEEEEccccEEEEEcHHHcccEEEEEEcccEEEEEEEEEEcccccHHHHHHHHHHHHHHcccccccccccEEEEEEEccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccc //