[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66063.1
DDBJ      :             cytochrome c type biogenesis protein CycH
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  92/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   70->108 PF07338 * DUF1471 0.00061 24.3 37/65  
:BLT:SWISS 11->126 YJEI_SHIFL 5e-14 37.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66063.1 GT:GENE ACF66063.1 GT:PRODUCT cytochrome c type biogenesis protein CycH GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 439093..439476 GB:FROM 439093 GB:TO 439476 GB:DIRECTION + GB:PRODUCT cytochrome c type biogenesis protein CycH GB:PROTEIN_ID ACF66063.1 GB:DB_XREF GI:194405844 LENGTH 127 SQ:AASEQ MINRPGISMKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDITGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSKQTNVTLSGNVYRCPR GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 11->126|YJEI_SHIFL|5e-14|37.3|110/117| HM:PFM:NREP 1 HM:PFM:REP 70->108|PF07338|0.00061|24.3|37/65|DUF1471| OP:NHOMO 107 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1----------------------------------------1--------------------------------1-------------------------------------------------------1----------------1111---1111111111-11111111111111111111--111112122222222222222111111111-111111111111---------11111--------------------------------------------------111111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,99-110| PSIPRED cccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEEEEEEEEccc //