[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66071.1
DDBJ      :             pyridoxal kinase
Swiss-Prot:PDXY_SALPA   RecName: Full=Pyridoxamine kinase;         Short=PM kinase;         EC=2.7.1.35;

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  150/199 : Viruses  0/175   --->[See Alignment]
c.72.1
:286 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->286 1td2A PDBj e-143 86.4 %
:RPS:PDB   1->268 2ddwB PDBj 7e-50 29.0 %
:RPS:SCOP  1->286 1td2A  c.72.1.5 * 2e-47 90.9 %
:HMM:SCOP  1->286 1lhpA_ c.72.1.5 * 1.8e-75 31.4 %
:RPS:PFM   76->257 PF08543 * Phos_pyr_kin 1e-18 35.6 %
:HMM:PFM   73->257 PF08543 * Phos_pyr_kin 3.7e-19 24.3 177/246  
:BLT:SWISS 1->286 PDXY_SALPA e-165 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66071.1 GT:GENE ACF66071.1 GT:PRODUCT pyridoxal kinase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1571940..1572800 GB:FROM 1571940 GB:TO 1572800 GB:DIRECTION + GB:PRODUCT pyridoxal kinase GB:NOTE identified by match to protein family HMM PF08543; match to protein family HMM TIGR00687 GB:PROTEIN_ID ACF66071.1 GB:DB_XREF GI:194405852 LENGTH 286 SQ:AASEQ MKNILAIQSHVVFGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGKWTGCVMPPSHLTEIVQGIADIGQLAHCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFCDPVMGHPEKGCIVAPGVAEFHVRYALPASDIIAPNLIELEILSKHSVNNVNDAVQAARELIAQGPEIVLVKHLARAGYSSERFEMLLVTAQEAWHISRPLVDFGSRQPVGVGDVTSGLLLVKLLQGATLQQALEHVTAAVYEIMIATKTMQEYELQVVAAQDRIANPEHYFSATRL GT:EXON 1|1-286:0| SW:ID PDXY_SALPA SW:DE RecName: Full=Pyridoxamine kinase; Short=PM kinase; EC=2.7.1.35; SW:GN Name=pdxY; OrderedLocusNames=SPA1403; SW:KW ATP-binding; Complete proteome; Kinase; Metal-binding;Nucleotide-binding; Transferase; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->286|PDXY_SALPA|e-165|100.0|286/286| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->286|1td2A|e-143|86.4|286/287| RP:PDB:NREP 1 RP:PDB:REP 1->268|2ddwB|7e-50|29.0|252/261| RP:PFM:NREP 1 RP:PFM:REP 76->257|PF08543|1e-18|35.6|174/245|Phos_pyr_kin| HM:PFM:NREP 1 HM:PFM:REP 73->257|PF08543|3.7e-19|24.3|177/246|Phos_pyr_kin| RP:SCP:NREP 1 RP:SCP:REP 1->286|1td2A|2e-47|90.9|286/287|c.72.1.5| HM:SCP:REP 1->286|1lhpA_|1.8e-75|31.4|283/309|c.72.1.5|1/1|Ribokinase-like| OP:NHOMO 534 OP:NHOMOORG 404 OP:PATTERN -------------------------------------------------------------------- -----111111---------------------------------1------1--------1111-------1111--11-1-1-----1111-------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------11------------------------------------------------------------------------------------1----------------------111------11-----1-1--11111111112-1111111111--1111-1111111111-1--21-11---------------1112-----------------------------------111111111111111-1111111111111---1--11---1--1--------------------------------------------------------------------------------------22----------------1------1---1--1----------21111312222222222-222222222222222222222211111222212222222222221122222--1111111-1111------------------111111--11-1111------------11111111-1111-111111111111-1111-----12-111111111111---------------------------1----------------------------------- ----111-211---11-1-1--11---1-111111-111111-1111-111-1-1-1-111112222222222222212222222222-111-11211111-111--13121112331-1--1132-2-481-4---1111111--111-1--3-111-1121311-1111121111119---112111-111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 100.0 SQ:SECSTR cccccccccccccccccHHHHHHHHHHTTccccccccEEEccccccccccEEEccHHHHHHHHHHHHHHTccTTccEEEcccccccHHHHHHHHHHHHHTTTcTTcEEEEccccEETTTEEcccccHHHHHHHTTTTTccEEcccHHHHHHHHTcccccHHHHHHHHHTTccccccEEEEEcccccccccEEccEEEEETTEEEccccEEccccccccccHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHTTcccccccGGHHHHHccccccccEEc PSIPRED ccEEEEEEcccccccccHHHHHHHHHHcccEEEEEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHHHcccEEEccHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEccccccccccccEEEEEEccccEEEEEEccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEc //