[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66072.1
DDBJ      :             competence damage-inducible protein A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  73/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 2->57 CINAL_SHIFL 5e-25 83.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66072.1 GT:GENE ACF66072.1 GT:PRODUCT competence damage-inducible protein A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2443420..2443596) GB:FROM 2443420 GB:TO 2443596 GB:DIRECTION - GB:PRODUCT competence damage-inducible protein A GB:PROTEIN_ID ACF66072.1 GB:DB_XREF GI:194405853 LENGTH 58 SQ:AASEQ MPDGTYALRMRFSAYRYSLAIRQEVCAVMALNMLRRWLNGEDITSEHGWIDVVESLTA GT:EXON 1|1-58:0| BL:SWS:NREP 1 BL:SWS:REP 2->57|CINAL_SHIFL|5e-25|83.9|56/400| OP:NHOMO 86 OP:NHOMOORG 73 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111111111-111111111111111111111111---21212222222122221---1111--111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,58-59| PSIPRED cccccEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHc //