[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66085.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66085.1 GT:GENE ACF66085.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 356332..356949 GB:FROM 356332 GB:TO 356949 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF66085.1 GB:DB_XREF GI:194405866 LENGTH 205 SQ:AASEQ MVKYHPVHVTKNRIKTDDVTDIYFVEPFWKEGENHIIESLMFFEELQKSFNLFNHKYGLNKYILRIPWEFVLIHMERISKLNSVGLFAVSVDFNNNHKFLSEYIRSRRDYGMEVWFDFCGKHSYSSEIKNLGFFFQACVVPRDPNFISSVYHYHKFQKILVGDINDVEQRAVYQNEVDYMYGMQWPSSYDGFFFRDHKKNETWCI GT:EXON 1|1-205:0| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--1-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccEEEEEEEEccccccccccEEEEEcHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHccccccccccEEEEcccccccccc //