[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66090.1
DDBJ      :             flagellar protein FlhE
Swiss-Prot:FLHE_SALTY   RecName: Full=Flagellar protein flhE;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->130 PF06366 * FlhE 9e-40 76.0 %
:HMM:PFM   4->130 PF06366 * FlhE 1.1e-53 61.9 126/131  
:BLT:SWISS 1->130 FLHE_SALTY 6e-74 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66090.1 GT:GENE ACF66090.1 GT:PRODUCT flagellar protein FlhE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2056160..2056552) GB:FROM 2056160 GB:TO 2056552 GB:DIRECTION - GB:PRODUCT flagellar protein FlhE GB:NOTE identified by match to protein family HMM PF06366 GB:PROTEIN_ID ACF66090.1 GB:DB_XREF GI:194405871 LENGTH 130 SQ:AASEQ MRKWLALLLFPLTVQAAGEGAWQDSGMGVTLNYRGVSASSSPLSARQPVSGVMTLVAWRYELNGPTPAGLRVRLCSQSRCVELDGQSGTTHGFAHVPAVEPLRFVWEVPGGGRLIPALKVRSNQVIVNYR GT:EXON 1|1-130:0| SW:ID FLHE_SALTY SW:DE RecName: Full=Flagellar protein flhE;Flags: Precursor; SW:GN Name=flhE; OrderedLocusNames=STM1912; SW:KW Bacterial flagellum biogenesis; Complete proteome;Direct protein sequencing; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|FLHE_SALTY|6e-74|100.0|130/130| GO:SWS:NREP 1 GO:SWS GO:0043064|"GO:flagellum organization"|Bacterial flagellum biogenesis| RP:PFM:NREP 1 RP:PFM:REP 5->130|PF06366|9e-40|76.0|125/129|FlhE| HM:PFM:NREP 1 HM:PFM:REP 4->130|PF06366|1.1e-53|61.9|126/131|FlhE| GO:PFM:NREP 1 GO:PFM GO:0019861|"GO:flagellum"|PF06366|IPR009420| OP:NHOMO 76 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-1111111111111111111---11---11111111111111111111111---1111111-1111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,32-51| PSIPRED cHHHHHHHHHHHHHHHccccEEEcccccEEEccccEEEEEcccccccccccEEEEEEEEEEEccccccccEEEEEccccEEEcccccccccccccccccccEEEEEEEcccccccccEEEEEEEEEEEEc //