[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66117.1
DDBJ      :             KDP operon transcriptional regulatory protein KdpE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  840/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->107 1zh4A PDBj 4e-43 95.3 %
:BLT:PDB   143->221 2zxjA PDBj 2e-11 35.4 %
:RPS:PDB   3->107 3cnbC PDBj 6e-13 17.1 %
:RPS:PDB   125->225 2d1vA PDBj 1e-20 28.7 %
:RPS:SCOP  4->103 1a0oA  c.23.1.1 * 6e-15 29.0 %
:RPS:SCOP  125->223 1gxpA  a.4.6.1 * 4e-23 29.6 %
:HMM:SCOP  1->189 1s8nA_ c.23.1.1 * 2e-39 33.2 %
:RPS:PFM   4->103 PF00072 * Response_reg 3e-09 35.0 %
:RPS:PFM   149->222 PF00486 * Trans_reg_C 2e-13 43.2 %
:HMM:PFM   4->112 PF00072 * Response_reg 1.6e-31 43.1 109/112  
:HMM:PFM   148->223 PF00486 * Trans_reg_C 2.4e-24 40.8 76/77  
:BLT:SWISS 1->224 KDPE_ECOLI 8e-98 86.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66117.1 GT:GENE ACF66117.1 GT:PRODUCT KDP operon transcriptional regulatory protein KdpE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(814760..815437) GB:FROM 814760 GB:TO 815437 GB:DIRECTION - GB:PRODUCT KDP operon transcriptional regulatory protein KdpE GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF00486 GB:PROTEIN_ID ACF66117.1 GB:DB_XREF GI:194405898 LENGTH 225 SQ:AASEQ MTNVLIVEDEQAIRRFLRAALEGDGLRVYEAETLQRGLLEAATRKPDLIILDLGLPDGDGIDFIRDLRQWSAIPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHAASPCADPIVRFSGVTVDLAARLIHRGDEEIHLTPIEFRLLAVLLNNTGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPTRPRHFITETGIGYRFMP GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 1->224|KDPE_ECOLI|8e-98|86.2|224/225| SEG 46->62|pdliildlglpdgdgid| SEG 108->121|lqarlrvalrrhaa| BL:PDB:NREP 2 BL:PDB:REP 1->107|1zh4A|4e-43|95.3|107/121| BL:PDB:REP 143->221|2zxjA|2e-11|35.4|79/100| RP:PDB:NREP 2 RP:PDB:REP 3->107|3cnbC|6e-13|17.1|105/123| RP:PDB:REP 125->225|2d1vA|1e-20|28.7|101/103| RP:PFM:NREP 2 RP:PFM:REP 4->103|PF00072|3e-09|35.0|100/111|Response_reg| RP:PFM:REP 149->222|PF00486|2e-13|43.2|74/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 4->112|PF00072|1.6e-31|43.1|109/112|Response_reg| HM:PFM:REP 148->223|PF00486|2.4e-24|40.8|76/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 4->103|1a0oA|6e-15|29.0|100/128|c.23.1.1| RP:SCP:REP 125->223|1gxpA|4e-23|29.6|98/103|a.4.6.1| HM:SCP:REP 1->189|1s8nA_|2e-39|33.2|187/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 7614 OP:NHOMOORG 845 OP:PATTERN -------------------------------------------------------------------- 7BD6H466778545AAA99-9F449A999997GCDE9EEB7AAC995766758A934711HFI5J6GLKL7333353347GA7133655552-3-----118222C3978--------------132222212211EFFGGD6CL5L9HBBB767AB756888997BHHL63734323524329C74423-A5CQQRQROPQHSPUTRNCF6489QTW79BR5DC988988bU6AA9A99899AAA9968996647499433336666894446745759A9454569977777777777444445555554453353333365QFIVNNNQQPRLPJEUPP6BC9QID79AFL52aVE89324546575127C54ABB744555CAGCB97A8D88D7767777766A-BBBBBHCE8E61JCCICAFHGCDBBF786779C7BC787AAAAAAAAABA76BA811111111--1122112222222221111247B458A96AIJMJMIDFFFBIIMNHFHG9FMJMHJIM12HJHE8D9AL9DBF4EGB6665441111111652AAC67531231463222-B7887776666469916522732222221111111114525666CD79A8C6C97CCFFE7FAGFFFFGBEHFF--22315------BBBABC9BCCCBCCDBB-CDCBBBBBBDCBBBBBBBAECE8B767BABBBBBBABBABABBAA9AAABB51999AA99A9999--1822222333357D8D333333144443--4A978A57768B9MKOMKPRQBJNMNCFHK32121322219BBFBBBBB9EDABHIA8C89BBA5545--71333344--------2-2-------------------------3633344444473 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-----------1------------9-----4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHcTTEEEEEEEccHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHGGGccHHHHccccEEETTEEEETTTTEEEETTEEccccHHHHHHHHHHHHTTTccccHHHHHHHHHcTTccccTHHHHHHHHHHHHHHcccTTccccEEEETTTEEEEcc DISOP:02AL 118-129| PSIPRED ccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHccccccccccEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHcccccccccEEEEEccccEEEcc //