[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66126.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:49 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->44 PF01682 * DB 0.00089 29.4 34/97  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66126.1 GT:GENE ACF66126.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1440573..1440722) GB:FROM 1440573 GB:TO 1440722 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF66126.1 GB:DB_XREF GI:194405907 LENGTH 49 SQ:AASEQ MYNRGDYQQNKIIRSECKILCSFADSSDYLSIAYYQTKIHSRHIFDVFF GT:EXON 1|1-49:0| HM:PFM:NREP 1 HM:PFM:REP 10->44|PF01682|0.00089|29.4|34/97|DB| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccHHHHHHHHHEEEEEEEcccccEEEEEEEEEEEcccEEEEEcc //