[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66188.1
DDBJ      :             ribosomal large subunit pseudouridine synthase E
Swiss-Prot:RLUE_SALTY   RecName: Full=Ribosomal large subunit pseudouridine synthase E;         EC=5.4.99.-;AltName: Full=rRNA-uridine isomerase E;AltName: Full=rRNA pseudouridylate synthase E;

Homologs  Archaea  0/68 : Bacteria  795/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
d.265.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->239 2omlA PDBj 2e-90 86.0 %
:RPS:PDB   23->243 3dh3B PDBj 5e-29 23.3 %
:RPS:SCOP  65->243 1przA  d.265.1.3 * 1e-35 19.1 %
:HMM:SCOP  47->242 1przA_ d.265.1.3 * 3.3e-40 31.1 %
:RPS:PFM   64->205 PF00849 * PseudoU_synth_2 5e-10 37.2 %
:HMM:PFM   65->210 PF00849 * PseudoU_synth_2 1.9e-16 20.9 139/164  
:HMM:PFM   205->230 PF06174 * DUF987 0.00015 38.5 26/66  
:BLT:SWISS 25->245 RLUE_SALTY e-128 99.1 %
:PROS 100->114|PS01149|PSI_RSU

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66188.1 GT:GENE ACF66188.1 GT:PRODUCT ribosomal large subunit pseudouridine synthase E GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1327888..1328625) GB:FROM 1327888 GB:TO 1328625 GB:DIRECTION - GB:PRODUCT ribosomal large subunit pseudouridine synthase E GB:NOTE identified by match to protein family HMM PF00849; match to protein family HMM TIGR00093 GB:PROTEIN_ID ACF66188.1 GB:DB_XREF GI:194405969 LENGTH 245 SQ:AASEQ MFCNEHVNTTLLFAAMKDTHYCAIMRQLISSENTMQKTSFRNHYIKRFSSRQASKSRKENQPKRVVLFNKPYDVLPQFTDEAGRRTLKDFIPVQGVYAAGRLDRDSEGLLVLTNDGALQARLTQPGKRTGKIYYVQVEGIPDNAALQALRTGVTLNDGPTLPAGIEMVAEPDWLWPRTPPIRERKNIPTSWLKVTLYEGRNRQVRRMTAHVGHPTLRLIRYSMGDYTLNGLDNGQWREIAQEKDR GT:EXON 1|1-245:0| SW:ID RLUE_SALTY SW:DE RecName: Full=Ribosomal large subunit pseudouridine synthase E; EC=5.4.99.-;AltName: Full=rRNA-uridine isomerase E;AltName: Full=rRNA pseudouridylate synthase E; SW:GN Name=rluE; OrderedLocusNames=STM1237; SW:KW Complete proteome; Isomerase; rRNA processing. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 25->245|RLUE_SALTY|e-128|99.1|221/221| GO:SWS:NREP 2 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| PROS 100->114|PS01149|PSI_RSU|PDOC00885| BL:PDB:NREP 1 BL:PDB:REP 60->239|2omlA|2e-90|86.0|179/181| RP:PDB:NREP 1 RP:PDB:REP 23->243|3dh3B|5e-29|23.3|202/241| RP:PFM:NREP 1 RP:PFM:REP 64->205|PF00849|5e-10|37.2|129/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 65->210|PF00849|1.9e-16|20.9|139/164|PseudoU_synth_2| HM:PFM:REP 205->230|PF06174|0.00015|38.5|26/66|DUF987| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 1 RP:SCP:REP 65->243|1przA|1e-35|19.1|173/252|d.265.1.3| HM:SCP:REP 47->242|1przA_|3.3e-40|31.1|190/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 1741 OP:NHOMOORG 816 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111--1111111--11111111111-1111111111111211111111-11--21122143212-------1-1-----1111111111-11111111112222222222222222222222222-21-1-12--11111--12-222-4444444344444422222244422232332222223332222222222222222222-11111111112211112222213333332333322222222222222222322222222333333333323323222222242422223233232111221111121111222222-22111322211111121111111111111111111111-2211111112112111222222221124122111112221111111111111222------------111111-11-11------1212-222232223223333333333333332332333331111123333111-3334334432243333232333211111111-11111111111211111131112--1----------------2111222332344624545555456644445-66465--2111211-11143332444444444444-4444444444444444444444333334444444444444444544434442-433343333444--1111111222224233222323232223222222222244322333333333-3333333---------343344444443444444444444411111112221111--------1-111111-1111---------------2112211111-22 -1--21------------------------------------------------------------------------------------------------------41-----------------------------------------------------2---------1-1--37212---1---1-233212- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 91.0 SQ:SECSTR ####################HHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTcccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccEEEEEEEcccccHHHHHHHHTccccccccccccEEEEcccEEcccEEEEEEEEEEEccccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTTccTTcEEEccHHH## DISOP:02AL 1-5,242-246| PSIPRED cccHHHccHHHHHHHHHHHHHHHHHcccEEEccEEEEEccccEEEEEcccEEcccccccccccEEEEEEccccEEEEEcccccccHHHHHcccccEEEEEcccccccEEEEEEccHHHHHHHHcHHHcccEEEEEEEEccccHHHHHHHHcccEEccEEccccEEEEEEcccccccEEEEEEEEccccEEEEEEEEEcccHHHHHHHHHHcccEEEEEEEEEEEEEEccccccccEEEccHHHcc //