[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66196.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->64 PF06279 * DUF1033 4.5e-06 16.7 54/120  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66196.1 GT:GENE ACF66196.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 185855..186163 GB:FROM 185855 GB:TO 186163 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF66196.1 GB:DB_XREF GI:194405977 LENGTH 102 SQ:AASEQ MLCGNVDAAAKLQYLHVTNGGMMAFYDDGNAKMCARCEPMVQNLKSMNNKAPYARWKQMGDVIKLKSPNSESDYKFYQQGEILSTWWIFNYKTLHALVDLSE GT:EXON 1|1-102:0| HM:PFM:NREP 1 HM:PFM:REP 11->64|PF06279|4.5e-06|16.7|54/120|DUF1033| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,102-103| PSIPRED cccccccccEEEEEEEEccccEEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHcccEEEEcccccccccHHHHcccEEEEEEEEEHHHHHHHHcccc //