[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66246.1
DDBJ      :             DNA damage-inducible protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  108/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->75 PF07130 * YebG 3e-18 68.0 %
:HMM:PFM   1->74 PF07130 * YebG 2.9e-36 60.8 74/75  
:HMM:PFM   61->91 PF11553 * DUF3231 0.00044 25.8 31/166  
:BLT:SWISS 1->83 YEBG_ECOLI 8e-30 75.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66246.1 GT:GENE ACF66246.1 GT:PRODUCT DNA damage-inducible protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2024264..2024554) GB:FROM 2024264 GB:TO 2024554 GB:DIRECTION - GB:PRODUCT DNA damage-inducible protein GB:NOTE identified by match to protein family HMM PF07130 GB:PROTEIN_ID ACF66246.1 GB:DB_XREF GI:194406027 LENGTH 96 SQ:AASEQ MAVEVKYVVIREGEEKMSFTSKKEADAWDKMLDTADLLDTWLEQSPVVLEDGQREALSLWLAEHKEVLSTILKTGKLPSPQAVEKDAASKTKKQAA GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 1->83|YEBG_ECOLI|8e-30|75.9|83/96| RP:PFM:NREP 1 RP:PFM:REP 1->75|PF07130|3e-18|68.0|75/75|YebG| HM:PFM:NREP 2 HM:PFM:REP 1->74|PF07130|2.9e-36|60.8|74/75|YebG| HM:PFM:REP 61->91|PF11553|0.00044|25.8|31/166|DUF3231| OP:NHOMO 108 OP:NHOMOORG 108 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1--1--11-111111111111111111111-------------11--1111111111-11-1111111111111111111111-----111-1111111111-11111---1--111111111111-----------------1------------------------------------------------------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 74-97| PSIPRED ccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccHHHHHccc //