[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66290.1
DDBJ      :             tetrathionate reductase subunit B
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  495/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->222 2vpyB PDBj 2e-30 39.3 %
:RPS:PDB   94->191 1a6lA PDBj 5e-12 16.5 %
:RPS:SCOP  43->224 1ti2B2  d.58.1.5 * 3e-50 31.1 %
:HMM:SCOP  41->222 1q16B_ d.58.1.5 * 5.2e-67 46.1 %
:HMM:PFM   48->63 PF00037 * Fer4 0.00017 50.0 16/24  
:HMM:PFM   125->146 PF00037 * Fer4 7.3e-10 50.0 22/24  
:HMM:PFM   3->23 PF10518 * TAT_signal 0.001 38.1 21/26  
:HMM:PFM   56->80 PF04879 * Molybdop_Fe4S4 0.00095 24.0 25/55  
:BLT:SWISS 42->190 PHSB_SALTY 3e-32 43.2 %
:PROS 132->143|PS00198|4FE4S_FER_1
:REPEAT 2|41->63|120->142
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66290.1 GT:GENE ACF66290.1 GT:PRODUCT tetrathionate reductase subunit B GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1475948..1476682) GB:FROM 1475948 GB:TO 1476682 GB:DIRECTION - GB:PRODUCT tetrathionate reductase subunit B GB:NOTE identified by match to protein family HMM PF00037; match to protein family HMM TIGR01409 GB:PROTEIN_ID ACF66290.1 GB:DB_XREF GI:194406071 LENGTH 244 SQ:AASEQ MDSSKRQFLQQLGVLTAGASLVPLAEAKFPFSPERHEGSPRHRYAMLIDLRRCIGCQSCTVSCTIENQTPQGAFRTTVNQYQVQREGSQEVTNVLLPRLCNHCDNPPCVPVCPVQATFQREDGIVVVDNKRCVGCAYCVQACPYDARFINHETQTADKCTFCVHRLEAGLLPACVESCVGGARIIGDIKDPHSRIATMLHQHRDAIKVLKPENGTSPHVFYLGLDDAFVTPLMGRAQPALWQEV GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 42->190|PHSB_SALTY|3e-32|43.2|148/192| PROS 132->143|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|41->63|120->142| SEG 106->114|ppcvpvcpv| BL:PDB:NREP 1 BL:PDB:REP 43->222|2vpyB|2e-30|39.3|173/193| RP:PDB:NREP 1 RP:PDB:REP 94->191|1a6lA|5e-12|16.5|97/106| HM:PFM:NREP 4 HM:PFM:REP 48->63|PF00037|0.00017|50.0|16/24|Fer4| HM:PFM:REP 125->146|PF00037|7.3e-10|50.0|22/24|Fer4| HM:PFM:REP 3->23|PF10518|0.001|38.1|21/26|TAT_signal| HM:PFM:REP 56->80|PF04879|0.00095|24.0|25/55|Molybdop_Fe4S4| RP:SCP:NREP 1 RP:SCP:REP 43->224|1ti2B2|3e-50|31.1|177/195|d.58.1.5| HM:SCP:REP 41->222|1q16B_|5.2e-67|46.1|180/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2285 OP:NHOMOORG 546 OP:PATTERN 22121321344333324-5574463113-113--111122221-1--11----12--525----2--- -7811-11111--1-1111-11--1211111-12221-111---11211-----1-----2122112-31---------6aR334222------------1----1-111---------------2243333332344411333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------133-1-----1----1411-111--1--9--12mi3354-5A91113----521--1------21--323-11--11111111112-2232232511----------1-1121-11212-1--31211111111311--6-3-----------------------------------122-33112122333333244444132223342-1232241443325213124---23----------92417B557995B755A168597683-AA99333526322112211-1-------292321163-111-----45886-5H9A9787BA8J8---1842------B5C899-FFFFFFEEFF-FFEGEFEFEFFFFDFFEE88998621BFEFFGFGGGGFEGEFE6AA9DCDE--455555545555---1---------1112-444434133232114-------1-12-22221-1--11114-------------2333111114422322------------122-111111--------------------------------------1-----1-121 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 82.8 SQ:SECSTR ################################HHHHHHHHHHHHHEEEccGGGGccccccHHccTTccccTTTTcccccccccccccccccHHEEEcGGGTTTcccHHHHHcTTccHEEEccccEEEcTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccHGcccccEEcccccccccEEEcccccEEEcGGGHHHHHHHHH########## DISOP:02AL 1-2,27-43,238-238,240-240,243-245| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccHHHHHHHHHHccccccccEEEEEEEEEEccccccccEEEEEHHcccccccHHHHHcccccccccccccccccHHHcccccccHHHcccccEEEEccccEEEEccccHHHHHccccccHHHHcccccEEEEEccccHHHHHHHHHHcccccccccHHHccccEEEEcccccccccccccccccHHHccc //