[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66313.1
DDBJ      :             universal stress protein C
Swiss-Prot:USPC_SALTY   RecName: Full=Universal stress protein C;

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->111 1jmvA PDBj 4e-14 37.6 %
:RPS:PDB   3->116 2dumD PDBj 2e-12 13.2 %
:RPS:SCOP  3->115 1jmvA  c.26.2.4 * 1e-15 36.3 %
:HMM:SCOP  3->138 1jmvA_ c.26.2.4 * 1.5e-22 27.4 %
:HMM:PFM   3->138 PF00582 * Usp 2.1e-17 22.1 136/140  
:BLT:SWISS 1->142 USPC_SALTY 2e-65 99.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66313.1 GT:GENE ACF66313.1 GT:PRODUCT universal stress protein C GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2071201..2071629 GB:FROM 2071201 GB:TO 2071629 GB:DIRECTION + GB:PRODUCT universal stress protein C GB:NOTE identified by match to protein family HMM PF00582 GB:PROTEIN_ID ACF66313.1 GB:DB_XREF GI:194406094 LENGTH 142 SQ:AASEQ MSYTHILVAVAVTPESHQLLAKAVSIARPVQAKVSLITLASDPELYNQFAAPMMEDLRAVMHEETENFLKMLEEKADYPIEQTFIASGELSQHILAVCRKHHVDLVICGNHNHSFFSRASCSAKSVVSASQVDVLLVPLAGD GT:EXON 1|1-142:0| SW:ID USPC_SALTY SW:DE RecName: Full=Universal stress protein C; SW:GN Name=uspC; Synonyms=uspS; OrderedLocusNames=STM1927; SW:KW Complete proteome; Cytoplasm. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|USPC_SALTY|2e-65|99.3|142/142| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 117->134|srascsaksvvsasqvdv| BL:PDB:NREP 1 BL:PDB:REP 3->111|1jmvA|4e-14|37.6|109/140| RP:PDB:NREP 1 RP:PDB:REP 3->116|2dumD|2e-12|13.2|114/141| HM:PFM:NREP 1 HM:PFM:REP 3->138|PF00582|2.1e-17|22.1|136/140|Usp| RP:SCP:NREP 1 RP:SCP:REP 3->115|1jmvA|1e-15|36.3|113/140|c.26.2.4| HM:SCP:REP 3->138|1jmvA_|1.5e-22|27.4|135/0|c.26.2.4|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 220 OP:NHOMOORG 116 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------5---------------------------1----22111213333333333-3333333333333333332222111112222222222222222232322331-211111111111--1---------------111111111111111---------------------------------------12211111123222------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 81.7 SQ:SECSTR cccTEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEEEHHHHHHHcccccHHHHHHHHHHHHHTTHHHHHHHTTEEEEEEEEEEEcHHHHHHHHHHHTTccEEEEEccccccc########################## DISOP:02AL 1-1,141-143| PSIPRED ccccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccc //