[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66317.1
DDBJ      :             putative stability protein StbD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:82 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->81 2a6qA PDBj 5e-07 20.5 %
:RPS:SCOP  10->81 2a6qA1  d.306.1.1 * 1e-07 22.2 %
:HMM:PFM   10->72 PF02604 * PhdYeFM 1.8e-09 22.2 63/75  
:BLT:SWISS 4->69 YAFN_ECOLI 7e-06 36.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66317.1 GT:GENE ACF66317.1 GT:PRODUCT putative stability protein StbD GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1673964..1674212) GB:FROM 1673964 GB:TO 1674212 GB:DIRECTION - GB:PRODUCT putative stability protein StbD GB:NOTE identified by match to protein family HMM PF02604 GB:PROTEIN_ID ACF66317.1 GB:DB_XREF GI:194406098 LENGTH 82 SQ:AASEQ MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERANERVIEVNIDDL GT:EXON 1|1-82:0| BL:SWS:NREP 1 BL:SWS:REP 4->69|YAFN_ECOLI|7e-06|36.5|63/97| RP:PDB:NREP 1 RP:PDB:REP 9->81|2a6qA|5e-07|20.5|73/86| HM:PFM:NREP 1 HM:PFM:REP 10->72|PF02604|1.8e-09|22.2|63/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 10->81|2a6qA1|1e-07|22.2|72/83|d.306.1.1| OP:NHOMO 61 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1--1-------------------------------------------------------------------------------1---11---------------1------------------------------1-------2-----------1-------------1----------------------------------------21---1---------------------------------------11--------1--------1-------------1--2112-----12--11--1--1-------1--1--------------------11------1---------111-----2----11--------1----------1----------1-1122222------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 90.2 SQ:SECSTR ########EEEEHHHHHHTHHHHHHHHHTccEEEEcTTccEEEEccHHHHHHHHHHHHHHHcHHHHHHHHTTcccccccccH DISOP:02AL 1-1| PSIPRED ccccHHcccEEEHHHHHccHHHHHHcccccEEEEEEcccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccc //