[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66331.1
DDBJ      :             putative periplasmic binding protein
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  486/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->237 1wdnA PDBj 4e-14 27.1 %
:RPS:PDB   30->238 3delB PDBj 2e-26 17.4 %
:RPS:SCOP  29->238 1ii5A  c.94.1.1 * 2e-29 18.7 %
:HMM:SCOP  25->253 2f34A1 c.94.1.1 * 1.1e-45 30.0 %
:RPS:PFM   40->253 PF00497 * SBP_bac_3 1e-24 33.0 %
:HMM:PFM   31->239 PF00497 * SBP_bac_3 1.7e-39 28.9 204/225  
:BLT:SWISS 10->189 ARTJ_ECOLI 7e-17 29.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66331.1 GT:GENE ACF66331.1 GT:PRODUCT putative periplasmic binding protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1771993..1772754 GB:FROM 1771993 GB:TO 1772754 GB:DIRECTION + GB:PRODUCT putative periplasmic binding protein GB:NOTE identified by match to protein family HMM PF00497 GB:PROTEIN_ID ACF66331.1 GB:DB_XREF GI:194406112 LENGTH 253 SQ:AASEQ MLSKKFGLSMIVLGIMSSSAFADSIVEGRTLNVAVSPASPPMLFKSADGKLQGIDLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKITLNNLNELNKYSIGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESRYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDSWMK GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 10->189|ARTJ_ECOLI|7e-17|29.0|169/243| BL:PDB:NREP 1 BL:PDB:REP 31->237|1wdnA|4e-14|27.1|199/223| RP:PDB:NREP 1 RP:PDB:REP 30->238|3delB|2e-26|17.4|201/232| RP:PFM:NREP 1 RP:PFM:REP 40->253|PF00497|1e-24|33.0|206/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 31->239|PF00497|1.7e-39|28.9|204/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 29->238|1ii5A|2e-29|18.7|198/222|c.94.1.1| HM:SCP:REP 25->253|2f34A1|1.1e-45|30.0|227/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1589 OP:NHOMOORG 511 OP:PATTERN -----1----------1-1111112--1--11-1----32221-1113----1----1---------- ---------------------2---1-----------1121-------1---212---------11-----1----------1--------------------------1---------------1-1-----------111111---1------11-------1--123--------------32--11---2-1111121-112111--1-221111--112322222221222222222222222122212212--2231311221-33134211144423331334444444444433322333333332546554444-2244221333321222332222-2-111--1----3-11-11-11-113-------121-2-11----------4543425545C--------117--844786655757-1----------1-111111111----1-21---------------------------1-1-----24234FDDEEE46666AA9E666656G9A263---1---2-1--22325--1---1341111111------115-334632633432-21-2------------31-1222221--11-1-1--21----433-2-----1-------1-----11----1-2-1--------55874675555553455-5555555555545455446887673317566677777777767955454551-645555554555--2-111111112--2421112-2-----111-11111--243--66566C77544452555----------11142222223422-----------------3----------------1-------------------------121-113111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 98.4 SQ:SECSTR ####EEEcTEEEEcccTTTcEEEEccTccEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEcccccccccGGGcccEEEETTcHHHHHHHHcTTHHHHHHcccEEEEccHHHHHHHHHTTcccEEEEcHHHHHGGGcTEEEEEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHTTHHHHHHHHHHT DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEccEEEEEEcccccccccHHHHcccEEEEEccccHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccccEEEccHHHHHHHHHcccccEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHcc //