[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66339.1
DDBJ      :             putative phage tail fiber assembly protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  8/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   90->171 PF02413 * Caudo_TAP 1e-09 37.8 %
:HMM:PFM   41->171 PF02413 * Caudo_TAP 2.1e-28 37.6 117/130  
:BLT:SWISS 1->100 TFA_BPP2 3e-13 36.0 %
:BLT:SWISS 110->171 TFA_BPAPS 1e-04 38.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66339.1 GT:GENE ACF66339.1 GT:PRODUCT putative phage tail fiber assembly protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2382414..2382941) GB:FROM 2382414 GB:TO 2382941 GB:DIRECTION - GB:PRODUCT putative phage tail fiber assembly protein GB:NOTE identified by match to protein family HMM PF02413 GB:PROTEIN_ID ACF66339.1 GB:DB_XREF GI:194406120 LENGTH 175 SQ:AASEQ MRHFKNFTKTTELTLVQQKLSENCSIQFIQDESGVDWYVLQKLFQPDTLKIQYDKTGLIIAADKDATKLFPLNCSVVEFADTDIPDGFQPGNFTYSNGVIAPVQIDYVALATADRDRRMTSVTAKINQLVEAQDDGDITAAELSELTALREYRTKLRRLALDVAPDINWPEYLNK GT:EXON 1|1-175:0| BL:SWS:NREP 2 BL:SWS:REP 1->100|TFA_BPP2|3e-13|36.0|100/175| BL:SWS:REP 110->171|TFA_BPAPS|1e-04|38.7|62/155| RP:PFM:NREP 1 RP:PFM:REP 90->171|PF02413|1e-09|37.8|82/123|Caudo_TAP| HM:PFM:NREP 1 HM:PFM:REP 41->171|PF02413|2.1e-28|37.6|117/130|Caudo_TAP| OP:NHOMO 60 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-12-----41-1----1------1-----12-2---211222--2---142-23122-----1-----11--1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------1-12-111------------------1----------------------------------------------------------------------------------------------1--------------------------- DISOP:02AL 1-2,174-176| PSIPRED ccccccccccccccHHHccHHHcccEEEEEcccccHHHHHHHccccHHEEEEEccccEEEEEEcHHHHHcccccEEEEEcccccccccccccEEEEccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //