[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66348.1
DDBJ      :             starvation-sensing protein RspB
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  714/915 : Eukaryota  186/199 : Viruses  1/175   --->[See Alignment]
b.35.1c.2.1
:339 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->336 1e3jA PDBj 3e-38 30.4 %
:RPS:PDB   1->338 1bxzA PDBj 1e-49 20.0 %
:RPS:SCOP  1->163 1bxzA1  b.35.1.2 * 5e-36 18.4 %
:RPS:SCOP  137->306 1pqwA  c.2.1.1 * 6e-13 8.3 %
:HMM:SCOP  1->170 1pl7A1 b.35.1.2 * 6.3e-57 42.9 %
:HMM:SCOP  134->302 1d1tA2 c.2.1.1 * 4.4e-24 28.6 %
:RPS:PFM   25->127 PF08240 * ADH_N 2e-29 52.4 %
:RPS:PFM   172->290 PF00107 * ADH_zinc_N 2e-07 31.6 %
:HMM:PFM   24->130 PF08240 * ADH_N 1.6e-38 47.7 107/109  
:HMM:PFM   171->296 PF00107 * ADH_zinc_N 2.7e-19 26.6 124/130  
:BLT:SWISS 1->339 RSPB_ECOLI e-157 75.2 %
:PROS 58->72|PS00059|ADH_ZINC

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66348.1 GT:GENE ACF66348.1 GT:PRODUCT starvation-sensing protein RspB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1630613..1631632 GB:FROM 1630613 GB:TO 1631632 GB:DIRECTION + GB:PRODUCT starvation-sensing protein RspB GB:NOTE identified by match to protein family HMM PF00107; match to protein family HMM PF08240 GB:PROTEIN_ID ACF66348.1 GB:DB_XREF GI:194406129 LENGTH 339 SQ:AASEQ MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGDNVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHAVMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWTLNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIYSSRLNANKFPVVIDWLNKGLIDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFAK GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 1->339|RSPB_ECOLI|e-157|75.2|339/339| PROS 58->72|PS00059|ADH_ZINC|PDOC00058| BL:PDB:NREP 1 BL:PDB:REP 3->336|1e3jA|3e-38|30.4|329/348| RP:PDB:NREP 1 RP:PDB:REP 1->338|1bxzA|1e-49|20.0|335/352| RP:PFM:NREP 2 RP:PFM:REP 25->127|PF08240|2e-29|52.4|103/108|ADH_N| RP:PFM:REP 172->290|PF00107|2e-07|31.6|117/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 24->130|PF08240|1.6e-38|47.7|107/109|ADH_N| HM:PFM:REP 171->296|PF00107|2.7e-19|26.6|124/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 2 RP:SCP:REP 1->163|1bxzA1|5e-36|18.4|163/178|b.35.1.2| RP:SCP:REP 137->306|1pqwA|6e-13|8.3|169/183|c.2.1.1| HM:SCP:REP 1->170|1pl7A1|6.3e-57|42.9|170/186|b.35.1.2|1/1|GroES-like| HM:SCP:REP 134->302|1d1tA2|4.4e-24|28.6|168/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 5207 OP:NHOMOORG 947 OP:PATTERN 231-2-9AFEDFEHF9284314-181114262----------------1-111-11121114322-45 96D-93154441-26BA88-8E22DR888888GMNNCLTO276AF7932421DAH624112285A3GFB922111-2----1C112111132-2-----2-2-3-71432--------------121-1-111--146643111286337221--------1--225878-------------54344541729444444562554445B66666444421283233333234233333333433334334451-5--3-6--144661-2123383223221222211222222223232222222222222322---222232-16332333323274111-1-1-21-111--212141221222231-3638622511--175B9B5-68855644544554446-65437747487-FFEAKFIGGDIL672436386678947444444446654-122------------------------------3A722-2223B99A9BA8687BBCE99991789C4B66--228232646542562-2-2-13-21211213155112321--1--12----33312122134945C34-----111111--------------33121234429312211223232211121121---131-------2654235C99DCDDDBC-9CBACBBBAC9CBCCBCC668656442A5B6B9D9ADC6A66A775677691-233333333333---1111113222112981113-2-111--23-33445151219175673735456564464111212111-1111111-11211145645442334222--11111111--------1--------31--1-------2------1311124333262 ----843-31---24INNLKHRFVVSKAA78678888A59776887GFGLJPggCFD99A7966D17355468378968A37766754-EZDN8E5IEC766AA6C-442O532362311128267293Da9-B6C4212412642321222262B36B5961973463984537346-711-35B8FOLGG33ONKG3 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 339 STR:RPRED 100.0 SQ:SECSTR cEEEEEEETTEEEEEEcccccccTTcEEEEEEEEEccHHHHHHHHccTTcccccEEcccEEEEEEEEEcTTcccccTTcEEEEcccccccccHHHHTTcGGGTTcTTTTTccccccccEEEccHHHHcEEccTTccHHHHTTTTHHHHHHHHHHHTTccTTccEEEEcccHHHHHHHHHHHHTTTcccEEEEcccHHHHHHHHHHTccEEEcGGGccHHHHHHHHHHTTTccEEEEEcTTHHHHHHHHEEEEEEEEEcccccccccTTTTTTcccEEEEccccccHHHHHHHHHHHHTTcccGGGGEEEEEcTHHHHHHHHHHHcccTTccEEEEEccc PSIPRED cEEEEEEccEEEEEEEEEcccccccEEEEEEEEEEEEccEEEEEEcccccccccEEcccccEEEEEEEcccccccccccEEEEcccccccccHHHcccccccccccEEEEEccccccEEEEEEcHHHEEEccccccHHHccEEccHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccEEEEEcccccccEEcHHHHEEccEEEEEEEccHHHHHHHHHHHHccccccHHHEEEEEEHHHHHHHHHHHHcccccEEEEEEEEcc //