[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66353.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->27 PF09808 * SNAPc_SNAP43 6.6e-05 45.5 22/194  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66353.1 GT:GENE ACF66353.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(545517..545639) GB:FROM 545517 GB:TO 545639 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF66353.1 GB:DB_XREF GI:194406134 LENGTH 40 SQ:AASEQ MRNRILEIIGNFYATYFLYTIQPIKFKFLPLIVLLLIINC GT:EXON 1|1-40:0| HM:PFM:NREP 1 HM:PFM:REP 6->27|PF09808|6.6e-05|45.5|22/194|SNAPc_SNAP43| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcc //