[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66362.1
DDBJ      :             suppression of copper sensitivity: lipoprotein modification in lgt mutants of E coli
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  186/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->204 3gykB PDBj 1e-13 28.0 %
:RPS:PDB   41->204 3dvxA PDBj 4e-19 15.2 %
:RPS:SCOP  35->197 1z6mA1  c.47.1.13 * 1e-13 22.3 %
:HMM:SCOP  31->199 1z6mA1 c.47.1.13 * 1.1e-39 31.5 %
:RPS:PFM   61->194 PF01323 * DSBA 3e-10 32.1 %
:HMM:PFM   57->195 PF01323 * DSBA 4.3e-26 31.7 139/193  
:BLT:SWISS 47->201 BDBD_BACSU 3e-12 28.4 %
:PROS 58->76|PS00194|THIOREDOXIN_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66362.1 GT:GENE ACF66362.1 GT:PRODUCT suppression of copper sensitivity: lipoprotein modification in lgt mutants of E coli GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1207176..1207799 GB:FROM 1207176 GB:TO 1207799 GB:DIRECTION + GB:PRODUCT suppression of copper sensitivity: lipoprotein modification in lgt mutants of E coli GB:NOTE identified by match to protein family HMM PF01323 GB:PROTEIN_ID ACF66362.1 GB:DB_XREF GI:194406143 LENGTH 207 SQ:AASEQ MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIVQKYPDVAVIIKPLPFKGESSVLAARIALTTWRDHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIRTNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 47->201|BDBD_BACSU|3e-12|28.4|155/222| PROS 58->76|PS00194|THIOREDOXIN_1|PDOC00172| BL:PDB:NREP 1 BL:PDB:REP 39->204|3gykB|1e-13|28.0|161/168| RP:PDB:NREP 1 RP:PDB:REP 41->204|3dvxA|4e-19|15.2|164/187| RP:PFM:NREP 1 RP:PFM:REP 61->194|PF01323|3e-10|32.1|134/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 57->195|PF01323|4.3e-26|31.7|139/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 35->197|1z6mA1|1e-13|22.3|157/172|c.47.1.13| HM:SCP:REP 31->199|1z6mA1|1.1e-39|31.5|165/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 241 OP:NHOMOORG 186 OP:PATTERN -------------------------------------------------------------------- --2--------------------------------------------------------------------------------------------------------------------------------------------------1-------------------11-------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11123322223332111111111-3-13216131211-11121121111112-11313211111211111111---11111---11111111111111111-1111-1-1-1---1-------------------------------------------------------------------------------1----1----------222222-----------------------------321----1--1--111--1---1--11111-------------1----1------1-1----------------------222----112111111111211111-------1-1-------1-------111111111--------------------------------------------------1-1-11-1-1111-----122------------------1-11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHcccccccccccccccTTTcEHHHHHTTTEEEcccccccccTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHccTEEEEEEEccccGGHHHHHHHHHHHTTcHHHHHHHHHHHHHTTcccTTcHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHHHHHTcccccEEEETTTEEccTTHHHHHHHHHHHHHHHHHTc DISOP:02AL 20-31,205-208| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHcccccccEEccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHcccccccEEEEccEEEcccccHHHHHHHHHHHHHHHccc //