[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66366.1
DDBJ      :             transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  462/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->151 2p6tF PDBj 3e-22 34.2 %
:RPS:PDB   5->151 2e1cA PDBj 3e-21 27.4 %
:RPS:SCOP  5->64 1i1gA1  a.4.5.32 * 4e-15 33.3 %
:RPS:SCOP  66->151 1ri7A2  d.58.4.2 * 1e-17 22.4 %
:HMM:SCOP  3->65 2cg4A1 a.4.5.32 * 2.6e-15 42.9 %
:HMM:SCOP  65->151 1ri7A2 d.58.4.2 * 1.2e-17 23.3 %
:RPS:PFM   82->141 PF01037 * AsnC_trans_reg 2e-05 26.7 %
:HMM:PFM   71->142 PF01037 * AsnC_trans_reg 7.3e-19 22.2 72/74  
:BLT:SWISS 5->151 YBAO_ECOLI 4e-33 44.9 %
:PROS 23->49|PS00519|HTH_ASNC_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66366.1 GT:GENE ACF66366.1 GT:PRODUCT transcriptional regulator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 355737..356192 GB:FROM 355737 GB:TO 356192 GB:DIRECTION + GB:PRODUCT transcriptional regulator GB:NOTE identified by match to protein family HMM PF01037 GB:PROTEIN_ID ACF66366.1 GB:DB_XREF GI:194406147 LENGTH 151 SQ:AASEQ MTEYLDDKDKELLKEIQKDCAQTLWQLAYKVGLTPTPCFKRLKKLKDRGVIIGQFALLDKEKLGLSLNVFIMINISEEQYASISEKIKSMPEVIAFYRISGSFNYLMHTVFTDMNDYYSFYEKIILTNSSISGSASSFVLEQIKETNELPV GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 5->151|YBAO_ECOLI|4e-33|44.9|147/152| PROS 23->49|PS00519|HTH_ASNC_1|PDOC00520| BL:PDB:NREP 1 BL:PDB:REP 5->151|2p6tF|3e-22|34.2|146/154| RP:PDB:NREP 1 RP:PDB:REP 5->151|2e1cA|3e-21|27.4|146/147| RP:PFM:NREP 1 RP:PFM:REP 82->141|PF01037|2e-05|26.7|60/74|AsnC_trans_reg| HM:PFM:NREP 1 HM:PFM:REP 71->142|PF01037|7.3e-19|22.2|72/74|AsnC_trans_reg| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 2 RP:SCP:REP 5->64|1i1gA1|4e-15|33.3|60/60|a.4.5.32| RP:SCP:REP 66->151|1ri7A2|1e-17|22.4|85/86|d.58.4.2| HM:SCP:REP 3->65|2cg4A1|2.6e-15|42.9|63/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 65->151|1ri7A2|1.2e-17|23.3|86/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 1871 OP:NHOMOORG 496 OP:PATTERN ---111313333333-2---1-12111---1-----------------------2323123---2-11 -11-5---222---3--23-21--2122222211111343---13-------4321----11413-3222-1----------------1111-2--1--11423232416---------------111----111--------------1---------------------------------211--------3333332212332351111-2322---11--------21----------------------------------------------------------------------------------------------1---1-11-1-1--------1------1-22---------------1--777411111328472225447366666665669-113118145D1-D887EDKDDGAA6364349D786779F1111111134431157------------------------------15C549AAAAHGGGJFEBBBBCDECDDDD8DDFE5787-1669368677372B1332----422222212---141----111--12----1------------1----------------------------11343221628422233212411113243122--1----------23352232222222222-2222222222222222222435233333234333343243444522222221-322222222222---2-----2222-152A11113112222111156555441213266668B5A48A773888---------1333443443858653311111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------1--1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 100.0 SQ:SECSTR HHHHccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHHHHHHHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHcTTEEEEEEEEccccccccccccc DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEEEcHHHHccccEEEEEEEEcHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccc //