[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66415.1
DDBJ      :             putative fimbrial protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.2.3
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   80->182 3bwuF PDBj 2e-09 21.1 %
:RPS:SCOP  42->182 1pdkB  b.2.3.2 * 2e-12 16.8 %
:HMM:SCOP  45->199 1qunB2 b.2.3.2 * 2.7e-16 28.3 %
:RPS:PFM   36->182 PF00419 * Fimbrial 1e-05 28.0 %
:HMM:PFM   36->199 PF00419 * Fimbrial 2.4e-15 25.2 147/153  
:BLT:SWISS 35->178 YADK_ECOLI 2e-15 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66415.1 GT:GENE ACF66415.1 GT:PRODUCT putative fimbrial protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(212518..213117) GB:FROM 212518 GB:TO 213117 GB:DIRECTION - GB:PRODUCT putative fimbrial protein GB:NOTE identified by match to protein family HMM PF00419 GB:PROTEIN_ID ACF66415.1 GB:DB_XREF GI:194406196 LENGTH 199 SQ:AASEQ MQQLLFLLRQPSLMLLMGLTGGFWSGISQAGSNLDINLTASIVNSTCKLSLENGGEVYLPNVTRAWFYNNDGSSKYAPTDEAGGTPFNVRLEDCADNSSIKQLMFSFTPQSGFWSNQNQVFKNDATTGAAQNVGIVIFSADYKTNVLNSDGSSNVVYDVSGKSSSLYLTDYQFYARYQNTGAVVSGVVTSNVLVDVSYE GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 35->178|YADK_ECOLI|2e-15|38.7|137/198| SEG 183->197|vvsgvvtsnvlvdvs| RP:PDB:NREP 1 RP:PDB:REP 80->182|3bwuF|2e-09|21.1|95/128| RP:PFM:NREP 1 RP:PFM:REP 36->182|PF00419|1e-05|28.0|132/152|Fimbrial| HM:PFM:NREP 1 HM:PFM:REP 36->199|PF00419|2.4e-15|25.2|147/153|Fimbrial| RP:SCP:NREP 1 RP:SCP:REP 42->182|1pdkB|2e-12|16.8|125/149|b.2.3.2| HM:SCP:REP 45->199|1qunB2|2.7e-16|28.3|120/0|b.2.3.2|1/1|Bacterial adhesins| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1111111111-1111111111111-11111--------1--1-1--11-1-11--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 62.8 SQ:SECSTR ############################################cccEEccccc#ccccccccTGGGccTTccc#####cccccEEEEEEEEEEcTTccEEEEEEEcccccT###ccTTcEEccccTTccccEEEEEEcTTcccccTTccGGGccEEEccTTcc####EEEEEEEEEEEccc################# DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccEEEEcccccEEEcccEEEEcccccccccccccccEEccccEEEEEEcccccccEEEEEEEEEEcccccccccEEEEEccccccccEEEEEEEEccccEEEEcccccccEEEEEEccccccccEEEEEEEEEEEcccEEEEEEEEEEEEEEEEc //