[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66416.1
DDBJ      :             formate dehydrogenase, gamma subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.21.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->202 1kqfC PDBj e-107 89.6 %
:RPS:SCOP  2->204 1kqfC  f.21.1.1 * 3e-81 98.0 %
:HMM:SCOP  2->217 1kqfC_ f.21.1.1 * 4.6e-56 24.5 %
:RPS:PFM   15->173 PF01292 * Ni_hydr_CYTB 2e-05 27.9 %
:HMM:PFM   9->186 PF00033 * Cytochrom_B_N 2.2e-24 19.8 177/188  
:BLT:SWISS 1->202 FDNI_SHIFL e-107 89.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66416.1 GT:GENE ACF66416.1 GT:PRODUCT formate dehydrogenase, gamma subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1697745..1698401) GB:FROM 1697745 GB:TO 1698401 GB:DIRECTION - GB:PRODUCT formate dehydrogenase, gamma subunit GB:NOTE identified by match to protein family HMM TIGR01583 GB:PROTEIN_ID ACF66416.1 GB:DB_XREF GI:194406197 LENGTH 218 SQ:AASEQ MSKSKMIVRTKFVDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFIALMFMFVRFVHHNIPDKKDIPWLKNIVEVLKGNEHKVADVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILMHAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEKGIQ GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 1->202|FDNI_SHIFL|e-107|89.6|202/217| TM:NTM 4 TM:REGION 18->40| TM:REGION 55->77| TM:REGION 115->137| TM:REGION 150->172| SEG 205->215|ekaeakkesek| BL:PDB:NREP 1 BL:PDB:REP 2->202|1kqfC|e-107|89.6|201/216| RP:PFM:NREP 1 RP:PFM:REP 15->173|PF01292|2e-05|27.9|147/178|Ni_hydr_CYTB| HM:PFM:NREP 1 HM:PFM:REP 9->186|PF00033|2.2e-24|19.8|177/188|Cytochrom_B_N| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF01292|IPR011577| GO:PFM GO:0016021|"GO:integral to membrane"|PF01292|IPR011577| RP:SCP:NREP 1 RP:SCP:REP 2->204|1kqfC|3e-81|98.0|203/216|f.21.1.1| HM:SCP:REP 2->217|1kqfC_|4.6e-56|24.5|216/0|f.21.1.1|1/1|Transmembrane di-heme cytochromes| OP:NHOMO 355 OP:NHOMOORG 255 OP:PATTERN -------------------------------------------------------------------- -11--------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11------1---------------------11--1-1---------------1-111112121-------------1111---1-1----11-11111111-----1-------------------------------------111111111111111111111111-11112121-111111-111111--11-----11----------111----1----------111---1--1111--2--1111111111-1--------31----1----------11322-1554423332222----3--------212213-2222222222-222222222222222222222211211222222222221212212222222--111111111111-------------1--1-111112111111--1----------1-11111-1--11112-------------1112111111111111----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 92.2 SQ:SECSTR #ccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcTTcGGGGGTTccHHHHHHHHHHHHHHHHHHHHHHHHHHGGGccccGGGHHHHHcHHHHHTTcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHTcTTTTGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTHHHHHHTcEEEHHHHHHHcHHHHH################ DISOP:02AL 1-3,201-219| PSIPRED cccHHHHEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcHHHHHHHHHHHHHHHHccccccHHHHccc //