[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66439.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   72->93 PF00028 * Cadherin 0.00049 31.8 22/93  
:BLT:SWISS 17->103 TRL_HELPY 1e-08 32.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66439.1 GT:GENE ACF66439.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1343168..1343482) GB:FROM 1343168 GB:TO 1343482 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF66439.1 GB:DB_XREF GI:194406220 LENGTH 104 SQ:AASEQ MTNKKHIFSIIFIGSLLTGCATGPSPTGIGLYTDVKGPITATSLPATKTGKACAQTVLGIVNTGDASIDSAKKAGDISLVSSVDYETTGSYPFYGKTCVVVRGQ GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 17->103|TRL_HELPY|1e-08|32.9|85/100| TM:NTM 1 TM:REGION 6->24| HM:PFM:NREP 1 HM:PFM:REP 72->93|PF00028|0.00049|31.8|22/93|Cadherin| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------1------------------------------------------------------1111111111111111------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEHHHHHcccccccccccEEEEEEEEEEEccccccccHHHHHHHHHHEEEEEEccccHHHHHHccccEEEEEEEEEEEEEEEEEEcEEEEEEEc //