[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF66455.1
DDBJ      :             glutathione S-transferase, N- domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  376/915 : Eukaryota  113/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->204 3gx0A PDBj e-101 83.3 %
:RPS:PDB   2->198 3einA PDBj 4e-39 25.7 %
:RPS:SCOP  2->112 1z9hA2  c.47.1.5 * 1e-11 17.5 %
:RPS:SCOP  91->203 1jlvA1  a.45.1.1 * 8e-21 24.5 %
:HMM:SCOP  1->84 1k0dD2 c.47.1.5 * 2.1e-19 47.5 %
:HMM:SCOP  78->203 1nhyA1 a.45.1.1 * 2.4e-34 40.2 %
:RPS:PFM   14->80 PF02798 * GST_N 9e-09 50.0 %
:RPS:PFM   131->196 PF00043 * GST_C 1e-06 42.6 %
:HMM:PFM   135->197 PF00043 * GST_C 3.6e-15 28.6 63/95  
:HMM:PFM   5->81 PF02798 * GST_N 3.6e-09 27.9 68/75  
:BLT:SWISS 1->208 YFCG_ECOLI e-102 83.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66455.1 GT:GENE ACF66455.1 GT:PRODUCT glutathione S-transferase, N- domain GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2505185..2505832 GB:FROM 2505185 GB:TO 2505832 GB:DIRECTION + GB:PRODUCT glutathione S-transferase, N- domain GB:NOTE identified by match to protein family HMM PF00043; match to protein family HMM PF02798 GB:PROTEIN_ID ACF66455.1 GB:DB_XREF GI:194406236 LENGTH 215 SQ:AASEQ MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAPADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNHFAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDLDSYPAVYNWFERIRTRPATARALLQAQLHCNSAKA GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 1->208|YFCG_ECOLI|e-102|83.2|208/215| BL:PDB:NREP 1 BL:PDB:REP 1->204|3gx0A|e-101|83.3|204/204| RP:PDB:NREP 1 RP:PDB:REP 2->198|3einA|4e-39|25.7|187/207| RP:PFM:NREP 2 RP:PFM:REP 14->80|PF02798|9e-09|50.0|60/71|GST_N| RP:PFM:REP 131->196|PF00043|1e-06|42.6|61/98|GST_C| HM:PFM:NREP 2 HM:PFM:REP 135->197|PF00043|3.6e-15|28.6|63/95|GST_C| HM:PFM:REP 5->81|PF02798|3.6e-09|27.9|68/75|GST_N| RP:SCP:NREP 2 RP:SCP:REP 2->112|1z9hA2|1e-11|17.5|103/113|c.47.1.5| RP:SCP:REP 91->203|1jlvA1|8e-21|24.5|110/123|a.45.1.1| HM:SCP:REP 1->84|1k0dD2|2.1e-19|47.5|80/102|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 78->203|1nhyA1|2.4e-34|40.2|122/144|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 1282 OP:NHOMOORG 489 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------733422-112211-2-111143341---------1-----------------------------------------------------------------------------------------------------1---11111111111111-------------1111111111-----------------------------------------------------5224-----327674424345522222222221-2444244A346-311244268546473224441111244--------176-1231-----------------------------12164-122175555654344455B44444347334463-133322312237241122----31-------12113-2-----------------------11-123---------------------------21331312413122111123322212221122---111-------232114-2222222222-2222222222222222223333342422212222322222222322222221-211111111111---2-----111211212111------------32333122213-55653645254543233-----------33111111112113423233222--------221111------------------------------------------------- ----77------1117774357579661222223332212222---365A45852226322241211113112221111112224422-9G271-11111313----1-31--------------------------------------------------------862---1-11219---116124433111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 100.0 SQ:SECSTR ccEEEEcTTcHHHHHHHHHHHHTcccEEEEccGGGTGGGcHHHHTTcTTccccEEEETEEETcccTEEEEcHHHHHHHHHHHccTTccccHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHTTTccccccccccHHHHHHHHHHHHHHHTTccGGGcHHHHHHHHHHHHcTTHHHHTHHTTTGGGGGGc DISOP:02AL 215-216| PSIPRED cEEEEEccccHHHHHHHHHHHcccccEEEEccccccccccHHHHHccccccccEEEEcccccccccEEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcc //